Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TNFAIP3 goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Monkey, Rabbit |
| Immunogen | TNFAIP3 antibody was raised against synthetic peptide from human TNFAIP3 / A20. |
Rabbit Polyclonal Anti-TNFAIP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFAIP3 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFAIP3. Synthetic peptide located within the following region: QENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHE |
TNFAIP3 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP |
TNFAIP3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TNFAIP3 |
TNFAIP3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TNFAIP3 |
TNFAIP3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TNFAIP3 (NP_006281.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TNFAIP3