Antibody Sample

View as table Download

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

CD274 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD274

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).

Rabbit Polyclonal PDL-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDL-2 antibody was raised against a 16 amino acid peptide from near the center of human PDL-2.

PD L2 (PDCD1LG2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 45-75 amino acids from the N-terminal region of Human CD273 / PDL2

Rabbit polyclonal TGFBR2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2.

Rabbit polyclonal anti-HER3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HER3.

Goat Polyclonal Antibody against PD-L1 / CD274

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CKKQSDTHLEET, from the C Terminus of the protein sequence according to NP_054862.1.

Rabbit monoclonal antibody against HER3/ErbB3 Phospho (pY1289) (EPR2325 ) (phospho-specific)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit polyclonal anti-HER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3.

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1250-1300 of Human ErbB-3.

Mouse Monoclonal Anti-PD-L2 Antibody [4E10]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L2 Antibody [8C12]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L2 Antibody [7C7]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L2 Antibody [7C1]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L2 Antibody [10H6]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L1 Antibody [4F2]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L1 Antibody [8E12]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal ErbB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

Goat Polyclonal Antibody against TPTE

Applications WB
Reactivities Test: Human. Expected from seq similarity: Human
Immunogen Peptide with sequence C-ERRTDKTHSEKFQ, from the internal region of the protein sequence according to NP_954870.2; NP_954868.1; NP_954869.1.

Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I).
Modifications Phospho-specific

Mouse Monoclonal Anti-PD-L1 Antibody [6H10]

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L1 Antibody [2D6]

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L1 Antibody [1F11]

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-PD-L1 Antibody [1D7]

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TGF beta Receptor II (TGFBR2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Goat Polyclonal Antibody against ERBB3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HSRLFPKANAQRT, from the C Terminus of the protein sequence according to NP_001973.2.

Rabbit polyclonal Anti-TPTE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST

Rabbit Polyclonal Anti-TPTE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Immunogen Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E)

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Immunogen Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E)

Rabbit polyclonal TGF beta Receptor II antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody.

Rabbit Polyclonal anti-PP2447 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PP2447 antibody: synthetic peptide directed towards the N terminal of human PP2447. Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Rabbit Polyclonal anti-TRABD antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRABD antibody: synthetic peptide directed towards the middle region of human TRABD. Synthetic peptide located within the following region: LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY

Rabbit Polyclonal Anti-TGFBR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Rabbit Polyclonal Anti-TPTE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY

Rabbit Polyclonal Anti-TPTE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV

Rabbit anti c-erbB3 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Mouse anti c-erbB-3/HER-3 Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated

Mouse anti MHC I (HLA-A,B,C) Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti TGF beta Receptor II Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TGFbR2