Germany
Japan
United Kingdom
China
Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Bovine, Human |
| Immunogen | KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR. |
Antibody Sample
View as table Download
Apolipoprotein A I (APOA1) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_000030.1. |
Goat Polyclonal Antibody against TPTE
| Applications | WB |
| Reactivities | Test: Human. Expected from seq similarity: Human |
| Immunogen | Peptide with sequence C-ERRTDKTHSEKFQ, from the internal region of the protein sequence according to NP_954870.2; NP_954868.1; NP_954869.1. |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP. |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 |
Rabbit Polyclonal PPAR-BP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP |
Rabbit Polyclonal PPAR-BP (Thr1457) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-BP around the phosphorylation site of Threonine 1457 |
| Modifications | Phospho-specific |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Anti-ANXA2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
TGF beta Receptor II (TGFBR2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human TGFβ RII. |
Prealbumin (TTR) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Transthyretin is the fastest protein in the immunoelectrophoresis pattern of human serum. It consists of four identical polypeptide chains with no carbohydrate The molecular weight is 55,000 and the concentration in normal serum ranges from 0.1 to 0.4 mg/ml. It can bind thyroxine and retinal and its concentration is reduced in severe liver diseases. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Apolipoprotein A I (APOA1) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Purified Human Apolipoprotein A1 |
Apolipoprotein A I (APOA1) sheep polyclonal antibody, HRP
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | Human Apolipoprotein A1 |
PINK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit Polyclonal ApoA1 Antibody
| Applications | WB |
| Reactivities | Chicken, Human |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1. |
Rabbit anti-SERPINA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINA1 |
Rabbit polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST |
Rabbit Polyclonal Anti-MBD4 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL |
Rabbit Polyclonal Anti-HLA-A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Rabbit anti pTEN(pS380) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DTSDP-- with phosphorylation sites at Ser385 of PTEN protein from human, mouse and rat origins. |
Rabbit anti pTEN (Paired S380) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DTSDP—without a phosphorylation site at Ser385 of human PTEN protein. This sequence is identical among human, mouse, rat , bovine and chicken origins. |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to the C-terminus of Human ErbB-3. |
TGFBR2 (27-85) sheep polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Chicken |
Active filters
Clonalities
- Polyclonal
Filter by
Category
Target Symbol
- PTEN (22)
- CASP8 (17)
- ERBB3 (14)
- SERPINA1 (11)
- ANXA2 (10)
- CFLAR (10)
- TGFBR2 (10)
- TTR (10)
- CD274 (9)
- TPTE (9)
- APOA1 (8)
- HLA-A (6)
- CASP8AP2 (5)
- GC (5)
- ASF1B (4)
- KRAS (4)
- MBD4 (4)
- MED1 (4)
- NAXE (4)
- PDCD1LG2 (4)
- ANXA2R (3)
- SHKBP1 (3)
- ARID1A (2)
- C2ORF76 (2)
- DEDD (2)
- HLA-A/B/C (2)
- ALKBH6 (1)
- HLA-A/F/H (1)
- PD-L1 (1)
Reactivities
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
Pathways
- Pathways in cancer (32)
- p53 signaling pathway (25)
- Apoptosis (21)
- Endocytosis (21)
- Viral myocarditis (14)
- Alzheimer's disease (13)
- Calcium signaling pathway (13)
- ErbB signaling pathway (13)
- Huntington's disease (13)
- NOD-like receptor signaling pathway (13)
- RIG-I-like receptor signaling pathway (13)
- Toll-like receptor signaling pathway (13)
- Endometrial cancer (12)
- Focal adhesion (12)
- Glioma (12)
- Inositol phosphate metabolism (12)
- Melanoma (12)
- Phosphatidylinositol signaling system (12)
- Prostate cancer (12)
- Small cell lung cancer (12)
- Tight junction (12)
- Complement and coagulation cascades (10)
- Adherens junction (7)
- Cell adhesion molecules (CAMs) (7)
- Chronic myeloid leukemia (7)
- Colorectal cancer (7)
- Cytokine-cytokine receptor interaction (7)
- MAPK signaling pathway (7)
- Pancreatic cancer (7)
- TGF-beta signaling pathway (7)
- PPAR signaling pathway (5)
- Base excision repair (2)
- Allograft rejection (1)
- Antigen processing and presentation (1)
- Autoimmune thyroid disease (1)
- Graft-versus-host disease (1)
- Natural killer cell mediated cytotoxicity (1)
- Type I diabetes mellitus (1)