Antibody Sample

cDNA Clones (13)
Antibodies (3)
Jump to Filters
View as table Download
FLASH (CASP8AP2) (NM_012115) Human Tagged ORF Clone
RC224342

USD 1,999.00

In Stock

CASP8AP2 (Myc-DDK-tagged)-Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FLASH (CASP8AP2) (NM_001137667) Human Tagged ORF Clone
RC226548

USD 1,999.00

In Stock

CASP8AP2 (Myc-DDK-tagged)-Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FLASH (CASP8AP2) (NM_001137668) Human Tagged ORF Clone
RC227738

USD 1,999.00

In Stock

CASP8AP2 (Myc-DDK-tagged)-Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FLASH (CASP8AP2) (NM_012115) Human Tagged ORF Clone
RG224342

USD 2,200.00

3 Weeks

CASP8AP2 (GFP-tagged) - Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FLASH (CASP8AP2) (NM_001137667) Human Tagged ORF Clone
RG226548

USD 2,200.00

3 Weeks

CASP8AP2 (GFP-tagged) - Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FLASH (CASP8AP2) (NM_001137668) Human Tagged ORF Clone
RG227738

USD 2,200.00

3 Weeks

CASP8AP2 (GFP-tagged) - Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA306039

USD 430.00

In Stock

Rabbit Polyclonal FLASH Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLASH antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy-terminus of human FLASH which differ from those of mouse by one amino acid.
FLASH (CASP8AP2) (NM_012115) Human Tagged ORF Clone
RC224342L1

USD 2,199.00

In Stock

Lenti ORF clone of Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FLASH (CASP8AP2) (NM_001137667) Human Tagged ORF Clone
RC226548L1

USD 2,199.00

3 Weeks

Lenti ORF clone of Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FLASH (CASP8AP2) (NM_012115) Human Untagged Clone
SC115516

USD 2,820.00

In Stock

CASP8AP2 (untagged)-Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA339709

USD 375.00

5 Days

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CASP8AP2 antibody: synthetic peptide directed towards the N terminal of human CASP8AP2. Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV
FLASH (CASP8AP2) (NM_001137667) Human Untagged Clone
SC325423

USD 2,820.00

3 Weeks

CASP8AP2 (untagged)-Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FLASH (CASP8AP2) (NM_001137668) Human Untagged Clone
SC325424

USD 2,820.00

3 Weeks

CASP8AP2 (untagged)-Human caspase 8 associated protein 2 (CASP8AP2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA351192

USD 345.00

In Stock

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASP8AP2