Germany
Japan
United Kingdom
China
USD 399.00
In Stock
Fluorescent Protein Antibodies
View as table Download
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
CD11b (ITGAM) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to a sequence shared between the Mouse (NP_001076429.1) and Human gene products (NP_001139280.1). After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
USD 240.00
2 Weeks
CD38 mouse monoclonal antibody, clone T16, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
CD38 mouse monoclonal antibody, clone T16, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 29A3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
USD 390.00
2 Weeks
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3B Isoform specific) mouse monoclonal antibody, clone 54B3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal ITGAX Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGAX antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1119-1145 amino acids from the C-terminal region of human ITGAX. |
CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD7 mouse monoclonal antibody, clone B-B7, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD22 mouse monoclonal antibody, clone B-ly8, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD38 mouse monoclonal antibody, clone T16, APC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | APC |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
USD 390.00
2 Weeks
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit polyclonal MME Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
CD3E mouse monoclonal antibody, clone JXT3, Aff - Purified
| Applications | ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD19 mouse monoclonal antibody, clone 4G7, Purified
| Applications | FC, IF |
| Reactivities | Human |
CD7 mouse monoclonal antibody, clone B-B7, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD7 mouse monoclonal antibody, clone B-B7, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD22 mouse monoclonal antibody, clone B-ly8, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD22 mouse monoclonal antibody, clone B-ly8, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal CD18/ITGB2 (Thr758) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD18/ITGB2 around the phosphorylation site of threonine 758 (S-A-TP-T-T). |
| Modifications | Phospho-specific |
Rabbit anti-FLT3 polyclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D). |
Active filters
Applications
- IF
Families
- Transmembrane
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Isotypes
Clonalities
Modifications
Pathways
- Hematopoietic cell lineage (146)
- Primary immunodeficiency (86)
- B cell receptor signaling pathway (62)
- Fc gamma R-mediated phagocytosis (62)
- Cell adhesion molecules (CAMs) (53)
- T cell receptor signaling pathway (37)
- Systemic lupus erythematosus (35)
- ECM-receptor interaction (19)
- Regulation of actin cytoskeleton (13)
- Pathways in cancer (10)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Dilated cardiomyopathy (8)
- Focal adhesion (8)
- Hypertrophic cardiomyopathy (HCM) (8)
- Cytokine-cytokine receptor interaction (6)
- Leukocyte transendothelial migration (6)
- Small cell lung cancer (6)
- Acute myeloid leukemia (4)
- Calcium signaling pathway (4)
- Metabolic pathways (4)
- Nicotinate and nicotinamide metabolism (4)
- Endocytosis (2)
- Melanogenesis (2)
- Alzheimer's disease (1)
- Chemokine signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Renin-angiotensin system (1)
- Viral myocarditis (1)