Germany
Japan
United Kingdom
China
Fluorescent Protein Antibodies
View as table Download
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |
Rabbit polyclonal FLT3 (Tyr842) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FLT3 around the phosphorylation site of tyrosine 842 (S-N-YP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal FLT3 (CD135) Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FLT3 (CD135) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-64 amino acids from the N-terminal region of human FLT3 (CD135). |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human KIT. |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal FLT3 (Tyr969) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FLT3 around the phosphorylation site of tyrosine 696 (H-T-YP-Q-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Kit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) pTyr721 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal CCR3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human CCR3. |
Rabbit anti-FLT3 polyclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D). |
Goat Polyclonal KIT/CD117 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1 |
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal anti-LTBR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit anti CD117/Kit (NT)/c-Kit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human Kit protein. This sequence is identical among human and dog origins. |
Rabbit anti CD117/Kit (IN)/c-Kit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from extracellular domain of Kit protein. This sequence is identical in human and dog origins. |
IL5RA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Clonalities
- Polyclonal
Pathways
- Cytokine-cytokine receptor interaction