Coronavirus Research Products

View as table Download

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

SARS M (C-term) rabbit polyclonal antibody, Serum

Applications EM, IF, IP, WB
Immunogen BSAcoupled Synthetic peptide corresponding to the C-terminus (amino acid residues 204-221) of the SARS Coronavirus Membrane protein

Rabbit Polyclonal Anti-ACE2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE2 Antibody: A synthesized peptide

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within aa 180-230 of ACE2.

Rabbit Polyclonal Anti-Masp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT

Rabbit Polyclonal Anti-CD147 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CD147 Antibody: A synthesized peptide derived from human CD147

SARS N rabbit polyclonal antibody, Purified

Applications ELISA, WB
Immunogen Recombinant protein corresponding to full length SARS Coronavirus Nucleocapsid protein

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a sequence within the amino terminus of Human ACE2.

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse