Research Areas

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

JNK1 (MAPK8) mouse monoclonal antibody, clone 4H6, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

JNK1 (MAPK8) mouse monoclonal antibody, clone 4H5, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

JNK1 (MAPK8) mouse monoclonal antibody, clone 1A2, Purified

Applications ELISA, IHC, WB
Reactivities Human

JNK1 (MAPK8) mouse monoclonal antibody, clone 3B12, Purified

Applications ELISA, IHC, WB
Reactivities Human

JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 380-420 of Human JNK3.

JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

JNK1 (MAPK8) pThr183 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-MAPK10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK10.

Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V).
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185
Modifications Phospho-specific

JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V).

JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V).

JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

JNK1 (MAPK8) (Thr183/Tyr185) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 159-195 amino acids from human MAPK8 / JNK1

Rabbit Polyclonal antibody to JNK1 (mitogen-activated protein kinase 8)

Applications IF, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 300 of JNK1 (Uniprot ID#P45983)

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Anti-MAPK8/MAPK9/MAPK10 (phospho-Thr183/Tyr185) Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Thr183/Tyr185 (M-M-T(p)-P-Y(p)- V - V ) derived from Human JNK1/JNK2/JNK3.
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK

JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal JNK1 Antibody

Applications WB
Reactivities C. elegans (Does not react with: Human, Mammalian, Mouse, Rat)
Conjugation Unconjugated
Immunogen A recombinant protein made to the C-terminus (residues 228-451) of the C. elegans JNK1 alpha protein.

Mouse Monoclonal JNK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) anti-JNK1 (MAPK8) mouse monoclonal antibody, clone OTI3B4H9 (formerly 3B4H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI2H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI10D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI4F9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MAPK8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 376-389 amino acids of Human mitogen-activated protein kinase 8