TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
Modifications | Phospho-specific |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Rabbit Polyclonal JNK1/2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Tobacco hornworm |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 2F3, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 4H6, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 4H5, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Anti-MAPK10 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10 |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
JNK2 (MAPK9) (1-425) mouse monoclonal antibody, clone 1C1-3A8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1A2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 3B12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1E2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 380-420 of Human JNK3. |
JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 (MAPK8) pThr183 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-MAPK10 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK10. |
Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V). |
Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183 |
Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185 |
Modifications | Phospho-specific |
JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V). |
JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V). |
JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
JNK1 (MAPK8) (Thr183/Tyr185) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 159-195 amino acids from human MAPK8 / JNK1 |
Rabbit Polyclonal antibody to JNK1 (mitogen-activated protein kinase 8)
Applications | IF, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 300 of JNK1 (Uniprot ID#P45983) |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Anti-MAPK8/MAPK9/MAPK10 (phospho-Thr183/Tyr185) Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of Thr183/Tyr185 (M-M-T(p)-P-Y(p)- V - V ) derived from Human JNK1/JNK2/JNK3. |
Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK |
JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal JNK1 Antibody
Applications | WB |
Reactivities | C. elegans (Does not react with: Human, Mammalian, Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | A recombinant protein made to the C-terminus (residues 228-451) of the C. elegans JNK1 alpha protein. |
Mouse Monoclonal JNK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-JNK1 (MAPK8) mouse monoclonal antibody, clone OTI3B4H9 (formerly 3B4H9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI2H6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI10D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI4F9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-MAPK8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 376-389 amino acids of Human mitogen-activated protein kinase 8 |