Research Areas

View as table Download

IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700023

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

IL6 mouse monoclonal antibody, clone B-E8, Azide Free

Applications ELISA, FC, FN
Reactivities Human

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta

Rabbit Polyclonal Caspase-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-1 antibody was raised against a 15 amino acid peptide from near the middle of human Caspase-1.

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

IL6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 26-55 amino acids from the Central region of Human Interleukin-6

Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 1.

Rabbit anti-IL1B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL1B

IL6 goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) recombinant human IL-6

IL6 rabbit polyclonal antibody, Azide Free

Applications ELISA, FN, WB
Reactivities Chicken
Immunogen Recombinant Chicken IL-6.

Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 1.

Mouse Monoclonal Caspase-1 Antibody (14F468)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

IL6 mouse monoclonal antibody, clone B-F6, Azide Free

Applications IP, WB
Reactivities Human

IL6 mouse monoclonal antibody, clone AT1F10, Purified

Applications ELISA, WB
Reactivities Human

IL6 mouse monoclonal antibody, clone AT1F10, Purified

Applications ELISA, WB
Reactivities Human

IL6 goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) recombinant human IL-6

Rabbit Polyclonal Caspase-1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-1 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-1.

Rabbit polyclonal Caspase 1 (Ser376) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 1 around the phosphorylation site of serine 376 (R-F-SP-F-E).
Modifications Phospho-specific

Rabbit Polyclonal Caspase-1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 371-390 RKVRFSFEQPDGRAQMPTTE of human Caspase-1.

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC

IL6 mouse monoclonal antibody, clone B-E8, PE

Applications FC
Reactivities Human
Conjugation PE

Rabbit polyclonal anti-IL-6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with recombinant human IL-6 produced in E.coli.

Rabbit Polyclonal Anti-IL6 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%).

Mouse anti IL-6 Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI10C5

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12C12

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1D11

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1E9

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B7

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2E9

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G5

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7D1

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B10

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI6D1

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI6D3

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7A4

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI8C8

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12E5

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B12

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3A3A8

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI4C4

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7D8

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B8

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12C5