IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700023 |
IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700023 |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
IL6 mouse monoclonal antibody, clone B-E8, Azide Free
Applications | ELISA, FC, FN |
Reactivities | Human |
IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta |
Rabbit Polyclonal Caspase-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Caspase-1 antibody was raised against a 15 amino acid peptide from near the middle of human Caspase-1. |
IL6 goat polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 26-55 amino acids from the Central region of Human Interleukin-6 |
Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 1. |
Rabbit anti-IL1B Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL1B |
IL6 goat polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (> 98%) recombinant human IL-6 |
IL6 rabbit polyclonal antibody, Azide Free
Applications | ELISA, FN, WB |
Reactivities | Chicken |
Immunogen | Recombinant Chicken IL-6. |
Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 1. |
Mouse Monoclonal Caspase-1 Antibody (14F468)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
IL6 mouse monoclonal antibody, clone B-F6, Azide Free
Applications | IP, WB |
Reactivities | Human |
IL6 mouse monoclonal antibody, clone AT1F10, Purified
Applications | ELISA, WB |
Reactivities | Human |
IL6 mouse monoclonal antibody, clone AT1F10, Purified
Applications | ELISA, WB |
Reactivities | Human |
IL6 goat polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (> 98%) recombinant human IL-6 |
Rabbit Polyclonal Caspase-1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Caspase-1 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-1. |
Rabbit polyclonal Caspase 1 (Ser376) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 1 around the phosphorylation site of serine 376 (R-F-SP-F-E). |
Modifications | Phospho-specific |
Rabbit Polyclonal Caspase-1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 371-390 RKVRFSFEQPDGRAQMPTTE of human Caspase-1. |
Rabbit Polyclonal Anti-IL33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC |
IL6 mouse monoclonal antibody, clone B-E8, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
Rabbit polyclonal anti-IL-6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with recombinant human IL-6 produced in E.coli. |
Rabbit Polyclonal Anti-IL6 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
Mouse anti IL-6 Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI10C5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12C12
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1D11
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI1E9
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B7
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2E9
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7D1
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B10
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI6D1
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI6D3
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7A4
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI8C8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12E5
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B12
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3A3A8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI4C4
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI7D8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2B8
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI12C5