Research Areas

View as table Download

Rabbit polyclonal anti-RORA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RORA.

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Rabbit polyclonal RORA Antibody (T216)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RORA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from human RORA.

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY

Rabbit Polyclonal Anti-Rora Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI

Carrier-free (glycerol/BSA-free) RORA mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORA mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORA mouse monoclonal antibody,clone OTI5A6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RORA rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORA

RORA mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORA mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORA mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORA mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORA mouse monoclonal antibody,clone OTI5A6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORA mouse monoclonal antibody,clone OTI5A6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated