Research Areas

Antibodies (152)
cDNA Clones (152)
Proteins (102)
Jump to Filters
View as table Download
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RC217862

USD 420.00

2 Weeks

MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RC217862L3

USD 620.00

6 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone Lentiviral Particle
RC217862L3V

USD 820.00

9 Weeks

Lenti ORF particles, MAPK9 (Myc-DDK tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RC217862L4

USD 620.00

6 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone Lentiviral Particle
RC217862L4V

USD 820.00

9 Weeks

Lenti ORF particles, MAPK9 (mGFP-tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_002750) Human Tagged ORF Clone Lentiviral Particle
RC218407L3V

USD 820.00

5 Weeks

Lenti ORF particles, MAPK8 (Myc-DDK tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_002750) Human Tagged ORF Clone Lentiviral Particle
RC218407L4V

USD 820.00

3 Weeks

Lenti ORF particles, MAPK8 (mGFP-tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139046) Human Tagged ORF Clone
RC222829L3

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139046) Human Tagged ORF Clone Lentiviral Particle
RC222829L3V

USD 820.00

6 Weeks

Lenti ORF particles, MAPK8 (Myc-DDK tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139046) Human Tagged ORF Clone
RC222829L4

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139046) Human Tagged ORF Clone Lentiviral Particle
RC222829L4V

USD 820.00

6 Weeks

Lenti ORF particles, MAPK8 (mGFP-tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139047) Human Tagged ORF Clone
RC222874L3

USD 650.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139047) Human Tagged ORF Clone Lentiviral Particle
RC222874L3V

USD 850.00

5 Weeks

Lenti ORF particles, MAPK8 (Myc-DDK tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139047) Human Tagged ORF Clone
RC222874L4

USD 650.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139047) Human Tagged ORF Clone Lentiviral Particle
RC222874L4V

USD 850.00

7 Weeks

Lenti ORF particles, MAPK8 (mGFP-tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139049) Human Tagged ORF Clone
RC222925L3

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139049) Human Tagged ORF Clone Lentiviral Particle
RC222925L3V

USD 820.00

5 Weeks

Lenti ORF particles, MAPK8 (Myc-DDK tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139049) Human Tagged ORF Clone
RC222925L4

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_139049) Human Tagged ORF Clone Lentiviral Particle
RC222925L4V

USD 820.00

7 Weeks

Lenti ORF particles, MAPK8 (mGFP-tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RC225304

USD 420.00

3 Weeks

MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RC225304L3

USD 620.00

8 Weeks

Lenti-ORF clone of MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone Lentiviral Particle
RC225304L3V

USD 820.00

11 Weeks

Lenti ORF particles, MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RC225304L4

USD 620.00

8 Weeks

Lenti-ORF clone of MAPK9 (mGFP-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone Lentiviral Particle
RC225304L4V

USD 820.00

11 Weeks

Lenti ORF particles, MAPK9 (mGFP-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK1 (MAPK8) (NM_001278548) Human Tagged ORF Clone
RC237356

USD 420.00

2 Weeks

MAPK8 (myc-DDK-tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ROCK1 (NM_005406) Human Tagged ORF Clone
RG211547

USD 1,560.00

3 Weeks

ROCK1 (GFP-tagged) - Human Rho-associated, coiled-coil containing protein kinase 1 (ROCK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK3 (MAPK10) (NM_138980) Human Tagged ORF Clone
RG217123

USD 460.00

3 Weeks

MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RG217862

USD 460.00

3 Weeks

MAPK9 (GFP-tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK1 (MAPK8) (NM_139046) Human Tagged ORF Clone
RG222829

USD 460.00

3 Weeks

MAPK8 (GFP-tagged) - Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RG225304

USD 460.00

3 Weeks

MAPK9 (GFP-tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325663

USD 345.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific
ROCK2 (NM_004850) Human Untagged Clone
SC117098

USD 2,820.00

In Stock

ROCK2 (untagged)-Human Rho-associated, coiled-coil containing protein kinase 2 (ROCK2)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
JNK3 (MAPK10) (NM_002753) Human Untagged Clone
SC109625

USD 760.00

In Stock

MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CD41 (ITGA2B) Rabbit Polyclonal Antibody
TA308579

USD 415.00

5 Days

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)
ROCK1 Rabbit Polyclonal Antibody
TA325814

USD 345.00

In Stock

Rabbit Polyclonal ROCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK1
JNK1 (MAPK8) (NM_139049) Human Untagged Clone
SC120589

USD 720.00

In Stock

MAPK8 (untagged)-Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325661

USD 345.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3
JNK3 (MAPK10) Rabbit Polyclonal Antibody
TA344632

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL
JNK3 (MAPK10) (NM_138982) Human Over-expression Lysate
LY403373

USD 605.00

5 Days

Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JNK1 (MAPK8) (NM_139049) Human Over-expression Lysate
LY408403

USD 605.00

In Stock

Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JNK3 (MAPK10) (NM_002753) Human Over-expression Lysate
LY419129

USD 396.00

In Stock

Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JNK1 (MAPK8) (NM_002750) Human Untagged Clone
SC109619

USD 660.00

In Stock

MAPK8 (untagged)-Human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
JNK2 (MAPK9) (NM_002752) Human Untagged Clone
SC111675

USD 310.00

In Stock

MAPK9 (untagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ROCK2 Rabbit Polyclonal Antibody
TA319779

USD 430.00

2 Weeks

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.
JNK3 (MAPK10) (NM_138981) Human Recombinant Protein
TP760300

USD 215.00

In Stock

Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
JNK3 (MAPK10) (NM_138982) Human Untagged Clone
SC109627

USD 760.00

In Stock

MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ROCK1 Rabbit Polyclonal Antibody
TA308951

USD 415.00

5 Days

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1
SOS1 Mouse Monoclonal Antibody [Clone ID: SOS-1]
AM03036PU-N

USD 240.00

2 Weeks

SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse