Research Areas

cDNA Clones (10)
Antibodies (2)
Proteins (1)
Jump to Filters
View as table Download
Granzyme H (GZMH) (NM_033423) Human Tagged ORF Clone
RC206685

USD 98.00

USD 390.00

In Stock

GZMH (Myc-DDK-tagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Granzyme H (GZMH) (NM_033423) Human Tagged ORF Clone
RG206685

USD 460.00

In Stock

GZMH (GFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Granzyme H (GZMH) (NM_001270781) Human Tagged ORF Clone
RC231906

USD 420.00

3 Weeks

GZMH (Myc-DDK tagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Granzyme H (GZMH) (NM_001270780) Human Tagged ORF Clone
RC236350

USD 420.00

2 Weeks

GZMH (myc-DDK-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Granzyme H (GZMH) (NM_001270781) Human Tagged ORF Clone
RG231906

USD 460.00

3 Weeks

GZMH (GFP-tagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Granzyme H (GZMH) Rabbit Polyclonal Antibody
AP20560PU-N

USD 370.00

2 Weeks

Granzyme H (GZMH) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human Granzyme H.
Granzyme H (GZMH) (BC027974) Human Untagged Clone
SC126062

USD 310.00

In Stock

GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX), mRNA (cDNA clone MGC:34849 IMAGE:5229314), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Granzyme H (GZMH) (NM_033423) Human Untagged Clone
SC125566

USD 310.00

In Stock

GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Granzyme H (GZMH) Rabbit Polyclonal Antibody
TA329501

USD 310.00

5 Days

Rabbit Polyclonal anti-GZMH antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMH antibody: synthetic peptide directed towards the N terminal of human GZMH. Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
Granzyme H (GZMH) (NM_001270780) Human Tagged ORF Clone
RG236350

USD 460.00

2 Weeks

GZMH (GFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Granzyme H (GZMH) (NM_001270781) Human Untagged Clone
SC330878

USD 310.00

3 Weeks

GZMH (untagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Granzyme H (GZMH) (NM_001270780) Human Untagged Clone
SC334244

USD 477.00

2 Weeks

GZMH (untagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Granzyme H (GZMH) Cytosection
TS406685P5

USD 889.00

4 Weeks

Transient overexpression of GZMH (NM_033423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack