Research Areas

View as table Download

GZMH (Myc-DDK-tagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GZMH (GFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GZMH (Myc-DDK tagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GZMH (myc-DDK-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GZMH (GFP-tagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GZMH rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GZMH

Granzyme H (GZMH) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human Granzyme H.

GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX), mRNA (cDNA clone MGC:34849 IMAGE:5229314), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal anti-GZMH antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMH antibody: synthetic peptide directed towards the N terminal of human GZMH. Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG

GZMH (GFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

3`UTR clone of granzyme H (cathepsin G-like 2 protein h-CCPX) (GZMH) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

GZMH (untagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3

Vector pCMV6 series
Tag Tag Free

GZMH (untagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of GZMH (NM_033423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack