GZMH (Myc-DDK-tagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GZMH (Myc-DDK-tagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GZMH (GFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GZMH (Myc-DDK tagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GZMH (myc-DDK-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GZMH (GFP-tagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GZMH rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GZMH |
Granzyme H (GZMH) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human Granzyme H. |
GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX), mRNA (cDNA clone MGC:34849 IMAGE:5229314), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
GZMH (untagged)-Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal anti-GZMH antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GZMH antibody: synthetic peptide directed towards the N terminal of human GZMH. Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG |
GZMH (GFP-tagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
3`UTR clone of granzyme H (cathepsin G-like 2 protein h-CCPX) (GZMH) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
GZMH (untagged) - Homo sapiens granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
GZMH (untagged) - Human granzyme H (cathepsin G-like 2, protein h-CCPX) (GZMH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GZMH (NM_033423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack