Research Areas

View as table Download

Rabbit Polyclonal TLR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal TLR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR1 antibody was raised against a peptide corresponding to 16 amino acids near the amino terminus of human TLR1.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal TLR9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR9 antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human TLR9.

TLR7 (900-950) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from a portion of amino acids 900-950 of Human TLR7

Rabbit Anti-Human TLR5 Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against synthetic peptide from human TLR5.

Rabbit Polyclonal TLR4 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a sythetic peptide corresponding to amino acids 420-456 of human TLR4.

Rabbit Polyclonal TLR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against a peptide corresponding to 15 amino acids near the carboxy terminus of human TLR3. The immunogen is located within amino acids 780 - 830 of TLR3.

Rabbit Polyclonal TLR5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against a peptide corresponding to 16 amino acids near the center of human TLR5.

Rabbit Polyclonal TLR5 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5.

TLR2 rabbit polyclonal antibody

Applications IHC, WB
Conjugation Unconjugated

Goat Polyclonal Antibody against IL12B / IL12p40

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2.

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit Polyclonal anti-TLR2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Rabbit Polyclonal anti-TLR6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT

Rabbit Polyclonal TLR4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TLR4 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TLR4.

Rabbit Polyclonal TLR8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TLR8 antibody was raised against a 13 amino acid synthetic peptide near the amino terminus of human TLR8. The immunogen is located within the first 50 amino acids of TLR8.

Rabbit Polyclonal TLR8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TLR8 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human TLR8. The immunogen is located within the last 50 amino acids of TLR8.

Anti-TLR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 611-786 amino acids of human toll-like receptor 1

Anti-TLR8 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human toll-like receptor 8

Anti-TLR8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human toll-like receptor 8

Anti-TLR7 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 62-348 amino acids of Human Toll-like receptor 7

Anti-TLR7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 62-348 amino acids of Human Toll-like receptor 7

Anti-TLR2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 143 amino acids of human toll-like receptor 2

Anti-TLR3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 726-904 amino acids of human toll-like receptor 3

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

Rabbit Monoclonal CD14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TLR2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TLR2

Rabbit Polyclonal Anti-TLR4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR4

Rabbit Polyclonal Anti-TLR5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR5

Rabbit Polyclonal Anti-TLR8 Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR8

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6

Rabbit Polyclonal Anti-TLR3 Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR3

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TLR6