HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Hfe (Myc-DDK-tagged) - Mouse hemochromatosis (Hfe)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Hfe (GFP-tagged) - Mouse hemochromatosis (Hfe), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 10
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (Myc-DDK-tagged)-Human hemochromatosis (HFE), transcript variant 11
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (myc-DDK-tagged) - Human hemochromatosis (HFE), transcript variant 12
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 10
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 9
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 11
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Hfe (Myc-DDK-tagged ORF) - Rat hemochromatosis (Hfe), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Hfe (myc-DDK-tagged) - Rat hemochromatosis (Hfe), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Hfe (myc-DDK-tagged) - Rat hemochromatosis (Hfe), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Hfe (untagged) - Mouse hemochromatosis (Hfe), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HFE (untagged)-Human hemochromatosis (HFE), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-HFE Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HFE antibody: synthetic peptide directed towards the C terminal of human HFE. Synthetic peptide located within the following region: FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS |
HFE (GFP-tagged) - Human hemochromatosis (HFE), transcript variant 12
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Hfe (untagged ORF) - Rat hemochromatosis (Hfe), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Hfe (untagged) - Rat hemochromatosis (Hfe), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Hfe (untagged) - Rat hemochromatosis (Hfe), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of hemochromatosis (HFE) transcript variant 8 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of hemochromatosis (HFE) transcript variant 4 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of hemochromatosis (HFE) transcript variant 7 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of hemochromatosis (HFE) transcript variant 3 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of hemochromatosis (HFE) transcript variant 9 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of hemochromatosis (HFE) transcript variant 6 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of hemochromatosis (HFE) transcript variant 1 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
HFE (untagged)-Human hemochromatosis (HFE), transcript variant 9
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HFE (untagged)-Human hemochromatosis (HFE), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HFE (untagged) - Human hemochromatosis (HFE), transcript variant 12
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of HFE (NM_000410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HFE (NM_139006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HFE (NM_139009) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack