Rabbit Anti-NMDA NR2B Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Anti-NMDA NR2B Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal GluR1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 |
USD 370.00
2 Weeks
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit anti-GRIA1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIA1 |
NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A. |
Rabbit Polyclonal NMDAR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
Rabbit Anti-NMDA NR2C Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the N-terminal region of the NR2C subunit |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
Modifications | Phospho-specific |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863 |
Modifications | Phospho-specific |
Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-NMDAR1(Ser897) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-NMDAR1(Ser897) Antibody: A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Sersine 897 |
Modifications | Phospho-specific |
GRIA1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
GRIA1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Ionotropic Glutamate receptor 2 (GRIA2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 860-910 of Human NMDAζ1. |
NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide mapping at the N-terminus of NMDAR2B of human origin |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K). |
Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR2B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B (Tyr1336) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1336 |
Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR2B (Tyr1474) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1474 |
Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 (Ser890) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Serine 890 |
Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 (Ser897) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Serine 897 |
Modifications | Phospho-specific |
Rabbit polyclonal GRIN2B (Phospho-Ser1303) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Modifications | Phospho-specific |
NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A |
Ionotropic Glutamate receptor 2 (GRIA2) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-GRIN1 (Phospho-Ser896) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 896 (R-R-S(p)-S-K) derived from Human NMDAR1. |
Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
USD 415.00
3 Days
Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rat, Zebrafish |
Immunogen | Peptide corresponding to amino acid residues from the C-terminal region of rat GluR2/3. |
NMDAR2B (GRIN2B) pTyr1474 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of Tyr1474 (H-V-YP-E-K) |
NMDAR2B (GRIN2B) pTyr1474 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of Tyr1474 (H-V-YP-E-K) |
NMDAR2B (GRIN2B) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthesized non-phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1474 (H-V-YP-EK) |
NMDAR2B (GRIN2B) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthesized non-phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1474 (H-V-YP-EK) |
GRIA1 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthesized non-phosphopeptide derived from human GluR1 around the phosphorylation site of serine 863 (R-N-SP-G-A) |
GRIA1 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthesized non-phosphopeptide derived from human GluR1 around the phosphorylation site of serine 863 (R-N-SP-G-A) |
NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 895~899 (R-S-S-K-D)from Human NMDAR1. |
NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 895~899 (R-S-S-K-D)from Human NMDAR1. |
NMDAR2B (GRIN2B) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to the C-terminus of Human NMDAε2 |
NMDAR1 (GRIN1) pSer897 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
NMDAR1 (GRIN1) pSer896 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from Human NMDAζ1 around the phosphorylation site of Serine 896 |
NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
GRIA1 pSer836 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around phosphorylation site of serine 836 derived from Human GluR1 |
GRIA1 pSer836 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around phosphorylation site of serine 836 derived from Human GluR1 |
GRIA1 (831-835) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Peptide sequence around aa. 831~835 derived from Human GluR1 |