Products

Jump to Filters
View as table Download
GTF2A1 Rabbit Polyclonal Antibody
TA332624

USD 275.00

3 Weeks

Rabbit anti-GTF2A1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GTF2A1
GTF2A1 Rabbit Polyclonal Antibody
TA344433

USD 475.00

5 Days

Rabbit Polyclonal Anti-GTF2A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the middle region of human GTF2A1. Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG
GTF2A1 Rabbit Polyclonal Antibody
TA344434

USD 475.00

5 Days

Rabbit Polyclonal Anti-GTF2A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the N terminal of human GTF2A1. Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
GTF2A1 (TFIIA-alpha) Rabbit Polyclonal Antibody
AP20422PU-N

USD 407.00

2 Weeks

GTF2A1 (TFIIA-alpha) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GTF2A1 Rabbit Polyclonal Antibody
TA329243

USD 375.00

5 Days

Rabbit Polyclonal anti-GTF2A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the C terminal of human GTF2A1. Synthetic peptide located within the following region: QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN
GTF2A1 Rabbit Polyclonal Antibody
TA362493

USD 360.00

5 Days

GTF2A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human GTF2A1