Products

View as table Download

Rabbit Polyclonal H3K9me3 Antibody

Applications Assay, Dot, ELISA, IF, WB
Reactivities Human, Mouse
Immunogen The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.

Rabbit polyclonal Histone H3 (Ab-28) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P).

Rabbit polyclonal anti-Histone H3.1 (Ser10) antibody (Phospho-specific)

Applications IHC, WB
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histone H3.1 around the phosphorylation site of serine 10 (R-K-SP-T-G).
Modifications Phospho-specific

Rabbit Polyclonal H3K4me3 Antibody

Applications Assay, Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K23ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K23ac antibody: histone H3 containing the acetylated lysine 23 (H3K23ac), using a KLH-conjugated synthetic peptide.

H3FA (HIST1H3A) pThr3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) pSer28 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) pSer10 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

H3FA (HIST1H3A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal Histone H3 (Ab-3) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q).

Rabbit polyclonal Histone H3 (Thr3) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of threonine 3 (A-R-TP-K-Q).
Modifications Phospho-specific

Rabbit anti Histone H3(Trimethylation at Lys4) Polyclonal Antibody

Applications IF, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing RT[Me3-K]QT in which Me3-K corresponds to trimethyl lysine 4 of human histone H3.

Rabbit anti Histone H3(Trimethylation at Lys9) Polyclonal Antibody

Applications IF, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing AR[Me3-K]ST in which Me3-K corresponds to trimethyl lysine 9 of human histone H3.

Rabbit anti Histone H3(Trimethylation at Lys27) Polyclonal Antibody

Applications IF, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing AR[Me3-K]SA in which Me3-K corresponds to trimethyl lysine 27 of human histone H3.

Rabbit anti Histone H3(Dimethylation at Lys9) Polyclonal Antibody

Applications IF, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing AR[Me2-K]ST in which Me2-K corresponds to Dimethyl lysine 9 of human histone H3.

Rabbit anti Histone H3(Dimethylation at Lys27) Polyclonal Antibody

Applications IF, IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing AR[Me2-K]ST in which Me2-K corresponds to Dimethyl lysine 27 of human histone H3.

Rabbit polyclonal Histone H3 (Ser28) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P).
Modifications Phospho-specific

Rabbit polyclonal Histone H3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Histone-3 was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to the c-terminus region of human histone-3.

Anti-HIST1H3A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human HIST1H3A

Rabbit Polyclonal Anti-HIST1H3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIST1H3A antibody: synthetic peptide directed towards the N terminal of human HIST1H3A. Synthetic peptide located within the following region: KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR

Rabbit anti Histone H3((Monomethylation at Lys4) Polyclonal Antibody

Applications IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti Histone H3(Monomethylation at Lys9) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing AR[Me1-K]ST in which Me2-K corresponds to Monomethyl lysine 9 of human histone H3.

Rabbit anti Monomethyl-Histone H3(Lys27) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing KAAR[Me1-K]SAP in which Me1-K corresponds to Monomethyl lysine 27 of human histone H3.

Rabbit anti Histone H3(Dimethylation at Lys4) Polyclonal Antibody

Applications IP
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing RT[Me2-K]QT in which Me2-K corresponds to dimethyl lysine 4 of human histone H3.

Rabbit anti Histone H3 (pSer10) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing -QTARKSTGGKA-with phosphorylated serine 10 of human Histone H3.

Rabbit anti Histone H3 Polyclonal Antibody

Applications IP
Reactivities Bovine, Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide within ~100 amino acids from N-terminus of human histone H3.

Rabbit anti Histone H3 (Acetylation at K4) Polyclonal Antibody

Applications Dot
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide containing ART[Acetyl-K]QTAR in which Acetylation site is located at lysine 4 of human histone H3.

Rabbit anti Histone H3 (Acetylation at K9) Polyclonal Antibody

Applications Dot
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide containing TAR[Acetyl-K]STGG in which Acetylation at lysine 9 of human histone H3

Rabbit anti Histone H3 (Citrulline at N-term) Polyclonal Antibody

Applications IF
Reactivities Bovine, Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide containing N-terminus of human histone H3 with citrulline modification at 2/8/17.