Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 30 of 30 results

(reset)

Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody

TA309730

USD 424.00

2 Weeks

Rabbit Polyclonal Lipase A Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571]

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Squalene Epoxidase (SQLE) Rabbit Polyclonal Antibody

TA346342

USD 475.00

5 Days

Rabbit Polyclonal Anti-SQLE Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CYP27B1 Rabbit Polyclonal Antibody

TA325091

USD 450.00

2 Weeks

Rabbit polyclonal CYP27B1 Antibody (C-term)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1.

1 / 3

2 / 3

3 / 3

Previous Next

Squalene Epoxidase (SQLE) (N-term) Rabbit Polyclonal Antibody

AP54036PU-N

USD 450.00

2 Weeks

Squalene Epoxidase (SQLE) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 67-97aa) of human Squalene epoxidase / SQLE

1 / 2

2 / 2

Previous Next

CYP51A1 Mouse Monoclonal Antibody [Clone ID: N6-P2H5*G8]

TA353141L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Cytochrome P450 51A1 Clone N6-P2H5*G8

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

FDFT1 Mouse Monoclonal Antibody [Clone ID: OTI1H9]

CF503450

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FDFT1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

FDFT1 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF503470

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FDFT1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

CF800765

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SOAT2 mouse monoclonal antibody,clone OTI2E12

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2D3]

CF800775

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SOAT2 mouse monoclonal antibody,clone OTI2D3

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

DHCR7 Rabbit Polyclonal Antibody

TA349889

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR7 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human DHCR7

1 / 2

2 / 2

Previous Next

Seladin 1 (DHCR24) Rabbit Polyclonal Antibody

TA350394

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human DHCR24

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Bile salt activated lipase (CEL) Rabbit Polyclonal Antibody

TA351006

USD 345.00

In Stock

Rabbit Polyclonal Anti-CEL Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human CEL

1 / 3

2 / 3

3 / 3

Previous Next

C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody

TA351165

USD 345.00

In Stock

Rabbit Polyclonal Anti-MSMO1 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MSMO1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TM7SF2 Rabbit Polyclonal Antibody

TA351818

USD 345.00

In Stock

Rabbit Polyclonal Anti-TM7SF2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human TM7SF2

1 / 3

2 / 3

3 / 3

Previous Next

FDFT1 Mouse Monoclonal Antibody [Clone ID: OTI1H9]

TA503450

USD 379.00

In Stock

FDFT1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

FDFT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]

TA503450AM

USD 420.00

4 Weeks

FDFT1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

FDFT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]

TA503450BM

USD 420.00

4 Weeks

FDFT1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

FDFT1 Mouse Monoclonal Antibody [Clone ID: OTI1H9]

TA503450S

USD 159.00

2 Days

FDFT1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

FDFT1 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA503470

USD 379.00

In Stock

FDFT1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

FDFT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]

TA503470AM

USD 420.00

4 Weeks

FDFT1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

FDFT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]

TA503470BM

USD 420.00

4 Weeks

FDFT1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

FDFT1 Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA503470S

USD 159.00

2 Days

FDFT1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

TA800765

USD 379.00

In Stock

SOAT2 mouse monoclonal antibody,clone OTI2E12

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E12]

TA800765AM

USD 420.00

5 Days

SOAT2 mouse monoclonal antibody,clone 2E12, Biotinylated

Applications	IHC
Reactivities	Human
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E12]

TA800765BM

USD 420.00

5 Days

SOAT2 mouse monoclonal antibody,clone 2E12, HRP conjugated

Applications	IHC
Reactivities	Human
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

TA800765S

USD 159.00

2 Days

SOAT2 mouse monoclonal antibody,clone OTI2E12

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2D3]

TA800775

USD 379.00

In Stock

SOAT2 mouse monoclonal antibody,clone OTI2D3

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D3]

TA800775AM

USD 420.00

5 Days

SOAT2 mouse monoclonal antibody,clone 2D3, Biotinylated

Applications	IHC
Reactivities	Human
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

TA800775BM

USD 420.00

5 Days

SOAT2 mouse monoclonal antibody,clone 2D3, HRP conjugated

Applications	IHC
Reactivities	Human
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2D3]

TA800775S

USD 159.00

2 Days

SOAT2 mouse monoclonal antibody,clone OTI2D3

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 30 of 30 results