Germany
Japan
United Kingdom
China
Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Equine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Products
View as table Download
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal beta-Arrestin 2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal GRAIL/RNF128 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal FNBP1 Antibody
| Applications | IHC |
| Reactivities | Equine, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 575-643 of human FNBP1 (isoform CRA_a) was used as the immunogen. 597 614 |
Active filters
Reactivities
- Equine
Applications
- IHC
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Families
Pathways
- Chemokine signaling pathway (2)
- MAPK signaling pathway (2)
- RIG-I-like receptor signaling pathway (2)
- Toll-like receptor signaling pathway (2)
- Acute myeloid leukemia (1)
- Adipocytokine signaling pathway (1)
- Apoptosis (1)
- B cell receptor signaling pathway (1)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- Cytosolic DNA-sensing pathway (1)
- Endocytosis (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- NOD-like receptor signaling pathway (1)
- Neurotrophin signaling pathway (1)
- Olfactory transduction (1)
- Pancreatic cancer (1)
- Pathways in cancer (1)
- Prostate cancer (1)
- Small cell lung cancer (1)
- T cell receptor signaling pathway (1)
- p53 signaling pathway (1)