Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DMGDH antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DMGDH. |
Products
View as table Download
Rabbit polyclonal anti-PIPOX antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIPOX. |
Rabbit polyclonal AOC3 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |
Rabbit Polyclonal Anti-CTH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK |
Rabbit Polyclonal Anti-PSAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY |
BHMT mouse monoclonal antibody, clone 3D6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BHMT mouse monoclonal antibody, clone 3D6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Goat Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2. |
Anti-AGXT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA |
Rabbit Polyclonal Anti-CTH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the N terminal of human CTH. Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF |
Rabbit Polyclonal Anti-SHMT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR |
Rabbit Polyclonal Anti-SHMT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE |
AGXT rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AGXT |
Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AMT |
CBSL rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CBS |
PHGDH (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH |
AOC2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
| Immunogen | Synthetic peptide directed towards the middle region of human AOC2 |
GCAT (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 100-128 amino acids from the N-terminal region of human AKB ligase / GCAT |
GLDC (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 56~85 amino acids from the N-terminal region of Human GLDC |
Goat Polyclonal Antibody against MAOB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Goat Polyclonal Antibody against Monoamine Oxidase A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1. |
Goat Anti-DAO / D-amino-acid oxidase (aa286-298) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RPQIRLEREQLRT, from the internal region of the protein sequence according to NP_001908.3. |
Anti-SHMT2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 240 amino acids of human serine hydroxymethyltransferase 2 (mitochondrial) |
Rabbit Polyclonal anti-GAMT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI |
Rabbit polyclonal Anti-SHMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG |
Rabbit Polyclonal Anti-PHGDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF |
Rabbit Polyclonal Anti-PHGDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE |
Rabbit Polyclonal Anti-ALAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALAS1 Antibody: synthetic peptide directed towards the N terminal of human ALAS1. Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS |
Rabbit Polyclonal Anti-AMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA |
Rabbit Polyclonal Anti-Dmgdh Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE |
Rabbit polyclonal Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA |
Rabbit polyclonal Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE |
Rabbit Polyclonal Anti-GLYCTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the N terminal of human GLYCTK. Synthetic peptide located within the following region: IQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGA |
Rabbit Polyclonal Anti-GLYCTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the middle region of human GLYCTK. Synthetic peptide located within the following region: KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS |
Active filters
Applications
- WB
Pathways
- Glycine