Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Goat Polyclonal Anti-NPHS2 / SRN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPHS2 / SRN1 Antibody: Peptide with sequence C-SPSKPVEPLNPKK, from the C Terminus of the protein sequence according to NP_055440.1. |
Rabbit Polyclonal AXIN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Goat Polyclonal Antibody against SMO (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit polyclonal anti-FZD10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
Rabbit polyclonal anti-TCF7L1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |
Rabbit Polyclonal Anti-Patched Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched |
Rabbit Polyclonal Anti-APC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APC Antibody: A synthesized peptide derived from human APC |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Goat Polyclonal Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody: Peptide with sequence C-QIPSTQFDAAHPTN, from the internal region of the protein sequence according to NP_001895.1. |
Goat Polyclonal Antibody against FZD7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1. |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit polyclonal anti-FZD8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD8 |
Active filters
Reactivities
- Mouse
Applications
- WB
Pathways
- Basal cell carcinoma
Filter by
Category
Target Symbol
- GLI1 (144)
- CTNNB1 (135)
- WNT3 (46)
- TP53 (37)
- PTCH1 (33)
- DVL2 (31)
- BMP4 (20)
- GLI2 (20)
- GSK3B (14)
- SHH (13)
- PTCH2 (11)
- APC (9)
- LEF1 (7)
- WNT3A (4)
- AXIN2 (3)
- BMP2 (3)
- SUFU (3)
- TCF7 (3)
- WNT1 (3)
- WNT10A (3)
- WNT10B (3)
- AXIN1 (2)
- DVL1 (2)
- DVL3 (2)
- FZD1 (2)
- FZD10 (2)
- FZD2 (2)
- FZD3 (2)
- FZD4 (2)
- FZD8 (2)
- FZD9 (2)
- SMO (2)
- WNT4 (2)
- WNT5A (2)
- WNT8B (2)
- WNT9A (2)
- WNT9B (2)
- APC2 (1)
- FZD5 (1)
- FZD7 (1)
- HHIP (1)
- STK36 (1)
- TCF7L1 (1)
- WNT11 (1)
- WNT16 (1)
- WNT2 (1)
- WNT5B (1)
- WNT6 (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (573)
- ES Cell Differentiation/IPS (424)
- Transcription Factors (330)
- Adult stem cells (205)
- Cancer stem cells (200)
- Embryonic stem cells (187)
- Stem cell relevant signaling - DSL/Notch pathway (146)
- Transmembrane (139)
- Secreted Protein (111)
- Stem cell - Pluripotency (37)
- Induced pluripotent stem cells (30)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (23)
- Protein Kinase (15)
- Stem cell relevant signaling - Wnt Signaling pathway (15)
- GPCR (13)