Products

View as table Download

ZNRD1 (myc-DDK-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3C (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2L (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2F (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3GL (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2C (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1D (GFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2K (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1D (GFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3D (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide D, 44kDa (POLR3D)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNRD1 (GFP-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3F (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1C (GFP-tagged) - Human polymerase (RNA) I polypeptide C, 30kDa (POLR1C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3K (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1E (GFP-tagged) - Human polymerase (RNA) I polypeptide E, 53kDa (POLR1E)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ZNRD1 (GFP-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2G (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide G (POLR2G)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1B (GFP-tagged) - Human polymerase (RNA) I polypeptide B, 128kDa (POLR1B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2J2 (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR2B (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide B, 140kDa (POLR2B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide D, 44kDa (POLR3D), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide E, 53kDa (POLR1E), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-POLR1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD

Lenti ORF clone of Human zinc ribbon domain containing 1 (ZNRD1), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

POLR2A (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal POLR2A (Ab-1619) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S).

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide D (POLR2D)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

POLR2L (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

POLR3A (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

ZNRD1 (untagged)-Human zinc ribbon domain containing 1 (ZNRD1), transcript variant a

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (POLR2J), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

POLR2H (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

POLR3B (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

POLR3F (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

POLR3C (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

POLR2E (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

POLR2C (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal anti-RPC4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC4.