ZNRD1 (myc-DDK-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant d
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ZNRD1 (myc-DDK-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant d
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
POLR3C (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2L (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2H (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2F (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3GL (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2C (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR1D (GFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2K (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR1D (GFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3D (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide D, 44kDa (POLR3D)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZNRD1 (GFP-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant b
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3F (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR1C (GFP-tagged) - Human polymerase (RNA) I polypeptide C, 30kDa (POLR1C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3K (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR1E (GFP-tagged) - Human polymerase (RNA) I polypeptide E, 53kDa (POLR1E)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZNRD1 (GFP-tagged) - Human zinc ribbon domain containing 1 (ZNRD1), transcript variant a
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2G (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide G (POLR2G)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR1B (GFP-tagged) - Human polymerase (RNA) I polypeptide B, 128kDa (POLR1B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2J2 (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR2B (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide B, 140kDa (POLR2B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide D, 44kDa (POLR3D), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) I polypeptide E, 53kDa (POLR1E), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-POLR1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD |
Lenti ORF clone of Human zinc ribbon domain containing 1 (ZNRD1), transcript variant b, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
POLR2A (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal POLR2A (Ab-1619) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide D (POLR2D)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
POLR2L (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POLR3A (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ZNRD1 (untagged)-Human zinc ribbon domain containing 1 (ZNRD1), transcript variant a
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (POLR2J), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
POLR2H (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POLR3B (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POLR3F (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POLR3C (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POLR2E (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
POLR2C (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-RPC4 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC4. |