Rabbit Polyclonal Anti-PARN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI3G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PARN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1). |
| Modifications | Unmodified |
PARN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1). |
| Modifications | Unmodified |
PARN mouse monoclonal antibody,clone OTI4D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 4D6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 4D6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PARN mouse monoclonal antibody,clone OTI4D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone OTI3G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 3G9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 3G9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PARN mouse monoclonal antibody,clone OTI3G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone UMAB143
| Applications | 10k-ChIP, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone UMAB143
| Applications | 10k-ChIP, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
