Products

Antibodies (51)
cDNA Clones (32)
Gene Expression (12)
Proteins (12)
RNAi (8)
Jump to Filters
View as table Download
PARN (NM_002582) Human Tagged ORF Clone
RC207220

USD 480.00

In Stock

PARN (Myc-DDK-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PARN (NM_002582) Human Tagged ORF Clone Lentiviral Particle
RC207220L1V

USD 880.00

3 Weeks

Lenti ORF particles, PARN (Myc-DDK tagged) - Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PARN (NM_002582) Human Tagged ORF Clone Lentiviral Particle
RC207220L2V

USD 880.00

6 Weeks

Lenti ORF particles, PARN (mGFP-tagged) - Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Parn (NM_028761) Mouse Tagged ORF Clone
MR209527

USD 580.00

In Stock

Parn (Myc-DDK-tagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PARN (NM_002582) Human Tagged ORF Clone
RG207220

USD 530.00

In Stock

PARN (GFP-tagged) - Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PARN Human Gene Knockout Kit (CRISPR)
KN407220

USD 1,290.00

2 Weeks

PARN - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407220 is the updated version of KN207220.
Parn Mouse Gene Knockout Kit (CRISPR)
KN512818

USD 1,290.00

2 Weeks

Parn - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512818 is the updated version of KN312818.
Parn (NM_028761) Mouse Tagged ORF Clone
MG209527

USD 640.00

3 Weeks

Parn (GFP-tagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parn (NM_028761) Mouse Tagged ORF Clone
MR209527L3

USD 780.00

3 Weeks

Lenti ORF clone of Parn (Myc-DDK-tagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parn (NM_028761) Mouse Tagged ORF Clone Lentiviral Particle
MR209527L3V

USD 980.00

6 Weeks

Lenti ORF particles, Parn (Myc-DDK-tagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parn (NM_028761) Mouse Tagged ORF Clone
MR209527L4

USD 780.00

3 Weeks

Lenti ORF clone of Parn (mGFP-tagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parn (NM_028761) Mouse Tagged ORF Clone Lentiviral Particle
MR209527L4V

USD 980.00

6 Weeks

Lenti ORF particles, Parn (GFP-tagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_002582) Human Tagged ORF Clone
RC207220L3

USD 680.00

3 Weeks

Lenti ORF clone of Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_002582) Human Tagged ORF Clone Lentiviral Particle
RC207220L3V

USD 880.00

5 Weeks

Lenti ORF particles, PARN (Myc-DDK tagged) - Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_002582) Human Tagged ORF Clone
RC207220L4

USD 680.00

3 Weeks

Lenti ORF clone of Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_002582) Human Tagged ORF Clone Lentiviral Particle
RC207220L4V

USD 880.00

7 Weeks

Lenti ORF particles, PARN (mGFP-tagged) - Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_001134477) Human Tagged ORF Clone
RC225978

USD 670.00

4 Weeks

PARN (Myc-DDK-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PARN (NM_001134477) Human Tagged ORF Clone
RC225978L3

USD 870.00

4 Weeks

Lenti-ORF clone of PARN (Myc-DDK-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_001134477) Human Tagged ORF Clone Lentiviral Particle
RC225978L3V

USD 1,070.00

7 Weeks

Lenti ORF particles, PARN (Myc-DDK-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_001134477) Human Tagged ORF Clone
RC225978L4

USD 870.00

4 Weeks

Lenti-ORF clone of PARN (mGFP-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_001134477) Human Tagged ORF Clone Lentiviral Particle
RC225978L4V

USD 1,070.00

7 Weeks

Lenti ORF particles, PARN (mGFP-tagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARN (NM_001242992) Human Tagged ORF Clone
RC234514

USD 480.00

5 Weeks

PARN (Myc-DDK tagged) - Homo sapiens poly(A)-specific ribonuclease (PARN), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PARN (NM_001134477) Human Tagged ORF Clone
RG225978

USD 740.00

4 Weeks

PARN (GFP-tagged) - Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PARN (NM_001242992) Human Tagged ORF Clone
RG234514

USD 530.00

5 Weeks

PARN (GFP-tagged) - Homo sapiens poly(A)-specific ribonuclease (PARN), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parn (NM_001270415) Rat Tagged ORF Clone
RR217019

USD 640.00

5 Weeks

Parn (myc-DDK-tagged) - Rat poly(A)-specific ribonuclease (Parn)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Parn (NM_028761) Mouse Untagged Clone
MC203133

USD 210.00

In Stock

Parn (untagged) - Mouse poly(A)-specific ribonuclease (deadenylation nuclease) (Parn), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PARN (NM_002582) Human Tagged ORF Clone
RC207220L1

USD 680.00

In Stock

Lenti ORF clone of Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PARN (NM_002582) Human Untagged Clone
SC118566

USD 310.00

In Stock

PARN (untagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PARN (NM_001134477) Human Untagged Clone
SC325208

USD 760.00

4 Weeks

PARN (untagged)-Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 2

Vector pCMV6 series
Tag Tag Free
PARN (NM_002582) Human Over-expression Lysate
LC419233

USD 121.00

In Stock

PARN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PARN (NM_002582) Human Tagged ORF Clone
RC207220L2

USD 680.00

3 Weeks

Lenti ORF clone of Human poly(A)-specific ribonuclease (deadenylation nuclease) (PARN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PARN Human shRNA Plasmid Kit (Locus ID 5073)
TR310606

USD 715.00

In Stock

PARN - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
PARN Human Gene Knockout Kit (CRISPR)
KN207220

USD 1,290.00

4 Weeks

PARN - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Parn Rabbit Polyclonal Antibody
TA329951

USD 310.00

5 Days

Rabbit Polyclonal Anti-PARN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ
PARN Mouse Monoclonal Antibody [Clone ID: OTI4D6]
CF802569

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4D6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI1G5]
CF802649

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI4E12]
CF802650

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI2D3]
CF802651

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI2D3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI3G9]
CF802652

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI3G9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI4C9]
CF802653

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4C9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI4D12]
CF802668

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI1G7]
CF802720

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARN Mouse Monoclonal Antibody [Clone ID: OTI2D9]
CF802721

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI2D9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human PARN activation kit by CRISPRa
GA103387

USD 1,290.00

2 Weeks

PARN CRISPRa kit - CRISPR gene activation of human poly(A)-specific ribonuclease

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Parn activation kit by CRISPRa
GA209722

USD 1,290.00

2 Weeks

Parn CRISPRa kit - CRISPR gene activation of mouse poly(A)-specific ribonuclease (deadenylation nuclease)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PARN Human qPCR Template Standard (NM_002582)
HK205411

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PARN

Application Plasmid of exact quantity for transcript copy number calculation
PARN Human qPCR Primer Pair (NM_002582)
HP206240

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PARN

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
PARN Human Gene Knockout Kit (CRISPR)
KN207220BN

USD 1,290.00

4 Weeks

PARN - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA mBFP-Neo
PARN Human Gene Knockout Kit (CRISPR)
KN207220LP

USD 1,290.00

4 Weeks

PARN - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA Luciferase-Puro