Products

View as table Download

Mouse Monoclonal SIRT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal SIRT6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the mouse SIRT6 protein (within residues 250-334). [Swiss-Prot P59941]

Rabbit Polyclonal Antibody against SIRT6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human SIRT6 protein (within residues 300-355). [Swiss-Prot Q8N6T7]

Rabbit Polyclonal Antibody against SIRT6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human SIRT6 protein (within residues 250-350). [Swiss-Prot Q8N6T7]

Chicken Polyclonal SIRT6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIRT6 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SIRT6.

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the middle region of human SIRT6. Synthetic peptide located within the following region: TRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVP

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG

Carrier-free (BSA/glycerol-free) SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIRT6 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 35-274 amino acids of human sirtuin 6

SIRT6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIRT6.

SIRT6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of mouse SIRT6 (NP_001156902.1).
Modifications Unmodified

SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated