PPARG (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPARG (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRA (Myc-DDK-tagged)-Human retinoid X receptor, alpha (RXRA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPARA (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRA (untagged)-Human retinoid X receptor, alpha (RXRA)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 98.00
USD 560.00
In Stock
RXRB (Myc-DDK-tagged)-Human retinoid X receptor, beta (RXRB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRG (Myc-DDK-tagged)-Human retinoid X receptor, gamma (RXRG), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPARD (untagged)-Human peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPARA (untagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human retinoid X receptor, beta (RXRB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |