Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-MDS032 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D) |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL |
Rabbit Polyclonal Anti-VTI1a Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a. |
Goat Polyclonal Anti-STX6 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli. |
Syntaxin 2 (STX2) (1-19) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Chicken, Drosophila, Hamster, Human, Insect, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | STX2 antibody was raised against rat syntaxin 2 synthetic peptide, corresponding to amino acid residues 1-19, conjugated to KLH. |
Rabbit polyclonal anti-VTI1B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human VTI1B. |
Rabbit polyclonal anti-VTI1A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VTI1A. |
Rabbit Polyclonal Syntaxin 1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A |
Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14 |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 92 and 297 of Syntaxin 4 (Uniprot ID#Q12846) |
Rabbit polyclonal anti-VAMP8 antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This VAMP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VAMP8. |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS |
VTI1A (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human VTI1A |
STX10 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 60-89 amino acids from the N-terminal region of Human STX10 |
Syntaxin 12 (STX12) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 223-251 amino acids from the C-terminal region of Human STX12 |
Syntaxin 16 (STX16) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 254-282 amino acids from the C-terminal region of Human STX16. |
Syntaxin 6 (STX6) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 120-149 amino acids from the Central region of human STX6 |
Syntaxin 8 (STX8) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 15-44 amino acids from the N-terminal region of human STX8 |
VAMP3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 14-43 amino acids from the Central region of human VAMP3 |
Goat Polyclonal Antibody against BNIP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLLRQRKTTKESLAQ, from the internal region of the protein sequence according to NP_001196.1; NP_053581.1; NP_053582.1; NP_053583.1. |
Goat Polyclonal Antibody against STX6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QALAERKNRQA, from the internal region of the protein sequence according to NP_005810.1. |
Goat Polyclonal Antibody against VTI1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDFDEKQQEANET, from the internal region of the protein sequence according to NP_006361.1. |
Rabbit polyclonal anti-STX1B antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STX1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human STX1B. |
Rabbit Polyclonal Anti-STX1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: EKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQT |
Rabbit Polyclonal Anti-VTI1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTI1A antibody: synthetic peptide directed towards the N terminal of human VTI1A. Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL |
Rabbit Polyclonal Anti-STX1A Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | STX1A / Syntaxin 1A antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Pig, Xenopus (100%); Panda, Dog, Bat, Bovine, Horse, Opossum, Turkey, Chicken (93%); Elephant (87%); Drosophila, Mosquito, Water flea, Nematode, Beetle (80%). |
Rabbit Polyclonal Anti-STX1A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%). |
Rabbit Polyclonal Anti-VAMP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |
Rabbit Polyclonal Anti-VAMP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK |
Rabbit Polyclonal Anti-GOSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOSR1 antibody: synthetic peptide directed towards the C terminal of human GOSR1. Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH |
Rabbit Polyclonal Anti-STX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the C terminal of human STX4. Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV |
Rabbit Polyclonal Anti-STX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the middle region of human STX4. Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE |
Rabbit Polyclonal Anti-VAMP8 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL |
Rabbit Polyclonal Anti-STX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS |
Rabbit Polyclonal Anti-STX8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Stx8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stx8. Synthetic peptide located within the following region: IISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLVDRK |
Rabbit Polyclonal Anti-VAMP1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vamp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Vamp1. Synthetic peptide located within the following region: MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRV |
Anti-BNIP1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 4-227 amino acids of human BCL2/adenovirus E1B 19kDa interacting protein 1 |
Anti-STX1A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX7 |
Active filters
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- SNARE interactions in vesicular transport