Rabbit Polyclonal Anti-CAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD. Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW |
Rabbit Polyclonal Anti-GFPT1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GFPT1 / GFAT antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Bovine, Horse, Pig, Opossum, Guinea pig (100%); Dog, Bat (93%); Turkey, Zebra finch, Chicken (86%). |
Rabbit Polyclonal Anti-ALDH5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM |
Rabbit Polyclonal Anti-GLUL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUL antibody: synthetic peptide directed towards the C terminal of human GLUL. Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS |
Rabbit Polyclonal Anti-ADSL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI |
Rabbit Polyclonal Anti-ASNS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
Rabbit Polyclonal Anti-DDO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDO antibody: synthetic peptide directed towards the N terminal of human DDO. Synthetic peptide located within the following region: TQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV |
Rabbit Polyclonal Anti-DDO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDO antibody: synthetic peptide directed towards the C terminal of human DDO. Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL |
Goat Anti-ALDH5A1 (aa 485-496), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SQDPAQIWRVAE., from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
Anti-ACY3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-GPT Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human glutamic-pyruvate transaminase (alanine aminotransferase) |
Anti-ALDH5A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 514-529 amino acids of human aldehyde dehydrogenase 5 family, member A1 |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 55-69 amino acids of Human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) |
Anti-AGXT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase |
Anti-ALDH4A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1 |
Rabbit Polyclonal Anti-ASPA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASPA |
Rabbit Polyclonal Anti-ASNS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASNS |
USD 345.00
4 Weeks
Rabbit Polyclonal Anti-GOT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GOT2 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Germany
Japan
United Kingdom
China
