ALX4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALX4 |
ALX4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALX4 |
ALX4 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 256-283 amino acids from the Central region of human ALX4 |
Rabbit Polyclonal Anti-ALX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSA |
Rabbit Polyclonal Anti-ALX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the middle region of human ALX4. Synthetic peptide located within the following region: GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISW |
Rabbit Polyclonal Anti-ALX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSA |
Rabbit Polyclonal Anti-ALX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESG |
Rabbit Polyclonal Anti-ALX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the C terminal of human ALX4. Synthetic peptide located within the following region: SVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKA |
Rabbit Polyclonal Anti-Alx4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Alx4 antibody: synthetic peptide directed towards the middle region of mouse Alx4. Synthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG |
Rabbit Polyclonal Anti-ALX4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALX4 |
ALX4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALX4 |
ALX4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ALX4 (NP_068745.2). |
Modifications | Unmodified |