Products

View as table Download

Rabbit polyclonal anti-RORA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RORA.

ROR alpha (RORA) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Rabbit polyclonal RORA Antibody (T216)

Applications IF, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This RORA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from human RORA.

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY

Rabbit Polyclonal Anti-Rora Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC

Rabbit Polyclonal Anti-RORA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI

Rabbit Polyclonal Anti-RORA rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORA

Rora Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rora

RORA Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse RORA

RORA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 169-468 of human RORA (NP_599024.1).
Modifications Unmodified