Products

Jump to Filters
View as table Download
Dopamine D2 Receptor (DRD2) Rabbit Polyclonal Antibody
TA316680

USD 425.00

5 Days

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).
5 HT 2A (HTR2A) Rabbit Polyclonal Antibody
RA24288-100

USD 490.00

2 Weeks

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA317650

USD 425.00

In Stock

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).
5 HT 2A (HTR2A) Rabbit Polyclonal Antibody
24288

USD 540.00

3 Days

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor.
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA327434

USD 275.00

3 Weeks

Rabbit anti-DRD1 Polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DRD1
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA347934

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5.
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA311880

USD 345.00

4 Weeks

Rabbit polyclonal anti-EDG2 / LPAR1 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EDG2.
Modifications Phospho-specific
HTR2C Rabbit Polyclonal Antibody
TA313299

USD 345.00

In Stock

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA329147

USD 310.00

In Stock

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
HTR2C Rabbit Polyclonal Antibody
RA24505-100

USD 490.00

2 Weeks

HTR2C rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA313441

USD 345.00

4 Weeks

Rabbit polyclonal anti-ADRB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB1 .
HTR2C Rabbit Polyclonal Antibody
24505

USD 510.00

3 Days

HTR2C rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA310064

USD 205.00

3 Weeks

Rabbit anti-LPAR1 polyclonal antibody

Applications WB
Reactivities Human, Bovine, Murine, Rat, Ovine
Conjugation Unconjugated
Immunogen Human LPA 1 amino acids 342-359
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA336498

USD 350.00

5 Days

Rabbit Polyclonal metabotropic Glutamate Receptor 1a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising internal residues of the human GluR1 alpha protein. Reacts with rat and mouse GluR1.
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA336513

USD 465.00

5 Days

Rabbit Polyclonal metabotropic Glutamate Receptor 1a Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising residues 1159-1171 [SSVPSSPVSESVL] of the human GluR1 protein.
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA341023

USD 425.00

5 Days

Rabbit Polyclonal Anti-GRM5 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GRM5 / MGLUR5 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM5 / MGLUR5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Horse, Rabbit, Pig, Turkey, Zebra finch, Chicken, Platypus, Lizard (100%); Xenopus (94%); Opossum, Pufferfish (88%); Zebrafish (82%).
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
HTR2C Goat Polyclonal Antibody
TA303035

USD 375.00

5 Days

Goat Polyclonal Antibody against HTR2C

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1.
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA311805

USD 345.00

4 Weeks

Rabbit polyclonal anti-DRD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internalof human DRD1.
Modifications Phospho-specific
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA311868

USD 345.00

4 Weeks

Rabbit polyclonal anti-GRM1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRM1.
DRD2
TA316681

USD 484.00

5 Days

Dopamine D2 Receptor (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Dog, Gorilla, Human, Rabbit, Horse (Predicted: Monkey, Pig)
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Ferret, Bat, Bovine, Dog, Elephant, Panda, Horse, Rabbit (100%); Gibbon, Monkey, Pig (94%); Marmoset (81%).
5 HT 2A (HTR2A) Rabbit Polyclonal Antibody
TA330446

USD 375.00

5 Days

Rabbit Polyclonal Anti-HTR2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2A antibody: synthetic peptide directed towards the N terminal of human HTR2A. Synthetic peptide located within the following region: DILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSEN
HTR2C Rabbit Polyclonal Antibody
TA330447

USD 310.00

5 Days

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA340759

USD 425.00

5 Days

Rabbit Polyclonal Anti-GRM1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GRM1 / MGLUR1 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Elephant, Panda, Bovine, Rabbit (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Dog, Bat, Horse, Opossum (94%); Chicken, Platypus (88%); Xenopus (82%).
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF503737

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA321176

USD 345.00

4 Weeks

Anti-ADRB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Beta-1 adrenergic receptor
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA321199

USD 345.00

4 Weeks

Anti-DRD1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA321200

USD 345.00

4 Weeks

Anti-DRD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321217

USD 345.00

4 Weeks

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321218

USD 345.00

In Stock

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA350844

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-LPAR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPAR1
HTR2C Rabbit Polyclonal Antibody
TA350954

USD 345.00

In Stock

Rabbit Polyclonal Anti-HTR2C Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR2C
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA358488

USD 360.00

5 Days

DRD1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA503737

USD 379.00

In Stock

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA503737S

USD 159.00

In Stock

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA890123

USD 345.00

In Stock

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA890123S

USD 159.00

2 Days

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5