Products

View as table Download

Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2. Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Goat Polyclonal Antibody against FOXA2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1.

Anti-FOXA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.

Rabbit Polyclonal PDX-1/IPF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945]

Rabbit Polyclonal FOXA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FOXA2 antibody was raised against a 16 amino acid peptide near the center of human FOXA2 .

Rabbit polyclonal IPF Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF.

Rabbit Polyclonal Anti-PDX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the middle region of human FOXA2. Synthetic peptide located within the following region: ASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALS

Rabbit Polyclonal Anti-Foxa2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxa2 antibody: synthetic peptide directed towards the middle region of mouse Foxa2. Synthetic peptide located within the following region: SSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGL

Rabbit anti FOXA-2 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FOXA2 protein. This sequence is identical to rat, mouse and human origins.

Rabbit anti PDX-1 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FOXA2 mouse monoclonal antibody, clone OTI3C10 (formerly 3C10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FOXA2 mouse monoclonal antibody, clone OTI3C10 (formerly 3C10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FOXA2 mouse monoclonal antibody, clone OTI3C10 (formerly 3C10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated