Products

View as table Download

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Rabbit Polyclonal Anti-F2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB

Rabbit polyclonal Prothrombin / THRB (AP2, Cleaved-Arg327) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human THRB.

Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5B11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5G10

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2