Products

View as table Download

Rabbit anti-SMAD4 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMAD4

Rabbit polyclonal SMAD4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4.

Rabbit Polyclonal Anti-Smad4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Smad4 Antibody: A synthesized peptide derived from human Smad4

Rabbit Polyclonal Anti-SMAD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the N terminal of human SMAD4. Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

Rabbit Polyclonal Antibody against SMAD4 (T277)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-284 amino acids from human SMAD4.

Rabbit polyclonal Smad4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Smad4.

Goat Polyclonal Antibody against SMAD4

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTMPIADPQPLD, from the C Terminus of the protein sequence according to NP_005350.1.

Rabbit Polyclonal Anti-SMAD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the middle region of human SMAD4. Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST

Rabbit Polyclonal Anti-Smad4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Smad4 antibody: synthetic peptide directed towards the middle region of human Smad4. Synthetic peptide located within the following region: YVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATST

Rabbit Polyclonal Anti-Smad4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Smad4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Smad4. Synthetic peptide located within the following region: AAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQL

Anti-SMAD4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4

SMAD4 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SMAD4