Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
TPM1 (Sarcomeric) mouse monoclonal antibody, clone ST-39, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Rabbit, Rat |
TPM1 (36Da) mouse monoclonal antibody, clone TM-36, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
Lenti-ORF clone of TPM1 (Myc-DDK-tagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti-ORF clone of TPM1 (mGFP-tagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 5
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TPM1 (untagged) - Human tropomyosin 1 (alpha) (TPM1), transcript variant Tpm1.8
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 (36/39kDa) mouse monoclonal antibody, clone TM-33, Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Tropomyosin-1 (TPM1) (1-284, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Tropomyosin-1 (TPM1) (1-284, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 7
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 7
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_000357)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018005)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018020)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018004)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018006)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018007)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TPM1 (GFP-tagged) - Human tropomyosin 1 (alpha) (TPM1), transcript variant Tpm1.8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
TPM1 (GFP-tagged) - Human tropomyosin 1 (alpha) (TPM1), transcript variant Tpm1.2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Human cDNA FLJ34732 fis, clone MESAN2006743, moderately similar to TROPOMYOSIN, FIBROBLAST ISOFORM TM3
| Vector | pCMV6 series |
| Tag | Tag Free |
TPM1 (untagged) - Human tropomyosin 1 (alpha) (TPM1), transcript variant Tpm1.2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-TPM1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
