Products

Antibodies (24)
cDNA Clones (17)
Proteins (11)
Jump to Filters
View as table Download
A RAF (ARAF) (NM_001654) Human Tagged ORF Clone
RC200737

USD 420.00

In Stock

ARAF (Myc-DDK-tagged)-Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
A RAF (ARAF) (NM_001654) Human Tagged ORF Clone
RG200737

USD 460.00

In Stock

ARAF (GFP-tagged) - Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A RAF (ARAF) (NM_001654) Human Tagged ORF Clone Lentiviral Particle
RC200737L3V

USD 820.00

5 Weeks

Lenti ORF particles, ARAF (Myc-DDK tagged) - Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A RAF (ARAF) (NM_001256197) Human Tagged ORF Clone
RC232019

USD 420.00

3 Weeks

ARAF (Myc-DDK tagged) - Homo sapiens v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A RAF (ARAF) (NM_001256196) Human Tagged ORF Clone
RC234556

USD 640.00

5 Weeks

ARAF (Myc-DDK tagged) - Homo sapiens v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A RAF (ARAF) (NM_001256197) Human Tagged ORF Clone
RG232019

USD 460.00

3 Weeks

ARAF (GFP-tagged) - Homo sapiens v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A RAF (ARAF) (NM_001256196) Human Tagged ORF Clone
RG234556

USD 700.00

5 Weeks

ARAF (GFP-tagged) - Homo sapiens v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A RAF (ARAF) (NM_001654) Human Untagged Clone
SC119127

USD 310.00

In Stock

ARAF (untagged)-Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
A RAF (ARAF) (NM_001654) Human Tagged ORF Clone
RC200737L1

USD 768.00

In Stock

Lenti ORF clone of Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
A RAF (ARAF) (NM_001654) Human Over-expression Lysate
LY400623

USD 396.00

In Stock

Transient overexpression lysate of v-raf murine sarcoma 3611 viral oncogene homolog (ARAF)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
A RAF (ARAF) (NM_001654) Human Untagged Clone
SC323512

USD 760.00

In Stock

ARAF (untagged)-Kinase deficient mutant (K336M) of Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
A RAF (ARAF) (NM_001654) Human Tagged ORF Clone
RC200737L2

USD 620.00

3 Weeks

Lenti ORF clone of Human v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
A RAF (ARAF) Rabbit Polyclonal Antibody
TA308536

USD 415.00

5 Days

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)
A RAF (ARAF) Rabbit Polyclonal Antibody
TA313468

USD 345.00

In Stock

Rabbit polyclonal anti-A-RAF antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human A-RAF.
A RAF (ARAF) (NM_001654) Human Over-expression Lysate
LC400623

USD 121.00

In Stock

ARAF HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
A RAF (ARAF) Rabbit Polyclonal Antibody
TA335018

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW
A RAF (ARAF) Rabbit Polyclonal Antibody
TA354371

USD 355.00

5 Days

Rabbit anti Raf -A Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A Synthetic peptide derived from N-term of Raf-A conjugated to KLH
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F8]
CF803658

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
CF803662

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G9]
CF803663

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF803675

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) (NM_001654) Human Mass Spec Standard
PH300737

USD 2,055.00

3 Weeks

ARAF MS Standard C13 and N15-labeled recombinant protein (NP_001645)

Tag C-Myc/DDK
Expression Host HEK293
A RAF (ARAF) (BC009028) Human Untagged Clone
SC125965

USD 310.00

3 Weeks

(untagged)-Human mRNA similar to raf-related oncogene (cDNA clone MGC:18177 IMAGE:4155318), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
A RAF (ARAF) (NM_001256197) Human Untagged Clone
SC330383

USD 310.00

3 Weeks

ARAF (untagged) - Homo sapiens v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), transcript variant 3

Vector pCMV6 series
Tag Tag Free
A RAF (ARAF) (NM_001256196) Human Untagged Clone
SC332316

USD 630.00

5 Weeks

ARAF (untagged) - Homo sapiens v-raf murine sarcoma 3611 viral oncogene homolog (ARAF), transcript variant 2

Vector pCMV6 series
Tag Tag Free
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F8]
TA803658

USD 379.00

In Stock

ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F8]
TA803658S

USD 159.00

2 Days

ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA803662

USD 379.00

In Stock

ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA803662S

USD 159.00

2 Days

ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G9]
TA803663

USD 379.00

In Stock

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G9]
TA803663AM

USD 420.00

4 Weeks

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
A RAF (ARAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G9]
TA803663BM

USD 420.00

4 Weeks

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2G9]
TA803663S

USD 159.00

2 Days

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
TA803675

USD 379.00

In Stock

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]
TA803675AM

USD 420.00

4 Weeks

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
A RAF (ARAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA803675BM

USD 420.00

4 Weeks

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
A RAF (ARAF) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
TA803675S

USD 159.00

2 Days

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
A RAF (ARAF) ICC Control Block
TB400737

USD 1,070.00

4 Weeks

Transient overexpression of ARAF (NM_001654) in HEK293T cells paraffin embedded controls for ICC/IHC staining

A RAF (ARAF) ICC Control Block
TB432019

USD 1,070.00

4 Weeks

Transient overexpression of ARAF (NM_001256197) in HEK293T cells paraffin embedded controls for ICC/IHC staining

A RAF (ARAF) ICC Control Block
TB434556

USD 1,290.00

4 Weeks

Transient overexpression of ARAF (NM_001256196) in HEK293T cells paraffin embedded controls for ICC/IHC staining

A RAF (ARAF) Cytosection
TS400737

USD 225.00

4 Weeks

Transient overexpression of ARAF (NM_001654) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

A RAF (ARAF) Cytosection
TS400737P5

USD 889.00

4 Weeks

Transient overexpression of ARAF (NM_001654) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack