Products

cDNA Clones (15)
Proteins (9)
Antibodies (3)
Jump to Filters
View as table Download
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone
RC219871

USD 550.00

2 Weeks

ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone
RC227559

USD 500.00

In Stock

ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone
RC219871L3

USD 750.00

4 Weeks

Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone Lentiviral Particle
RC219871L3V

USD 950.00

7 Weeks

Lenti ORF particles, ANAPC7 (Myc-DDK tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone
RC219871L4

USD 750.00

4 Weeks

Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone Lentiviral Particle
RC219871L4V

USD 950.00

7 Weeks

Lenti ORF particles, ANAPC7 (mGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone
RC227559L3

USD 700.00

3 Weeks

Lenti-ORF clone of ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone Lentiviral Particle
RC227559L3V

USD 900.00

6 Weeks

Lenti ORF particles, ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone
RC227559L4

USD 700.00

3 Weeks

Lenti-ORF clone of ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone Lentiviral Particle
RC227559L4V

USD 900.00

6 Weeks

Lenti ORF particles, ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone
RG219871

USD 600.00

3 Weeks

ANAPC7 (GFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone
RG227559

USD 550.00

3 Weeks

ANAPC7 (GFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) Rabbit Polyclonal Antibody
TA346133

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANAPC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Apc7 (ANAPC7) (C-term) Rabbit Polyclonal Antibody
AP23520PU-N

USD 440.00

2 Weeks

Apc7 (ANAPC7) (C-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ANAPC7 antibody was raised against synthetic peptide - KLH conjugated
Apc7 (ANAPC7) (NM_016238) Human Over-expression Lysate
LC414102

USD 187.00

In Stock

ANAPC7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Apc7 (ANAPC7) (NM_016238) Human Over-expression Lysate
LY414102

USD 605.00

In Stock

Transient overexpression lysate of anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Apc7 (ANAPC7) Rabbit Polyclonal Antibody
TA319926

USD 430.00

5 Days

Rabbit Polyclonal APC7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7.
Apc7 (ANAPC7) (NM_016238) Human Mass Spec Standard
PH319871

USD 2,055.00

3 Weeks

ANAPC7 MS Standard C13 and N15-labeled recombinant protein (NP_057322)

Tag C-Myc/DDK
Expression Host HEK293
Apc7 (ANAPC7) (NM_016238) Human Untagged Clone
SC314026

USD 1,020.00

3 Weeks

ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Apc7 (ANAPC7) (NM_001137664) Human Untagged Clone
SC326044

USD 910.00

3 Weeks

ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pCMV6 series
Tag Tag Free
Apc7 (ANAPC7) (NM_016238) Human Untagged Clone
SC327940

USD 1,020.00

3 Weeks

ANAPC7 (untagged)-Human anaphase promoting complex subunit 7 (ANAPC7) transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Apc7 (ANAPC7) (NM_016238) ICC Control Block
TB419871

USD 1,200.00

4 Weeks

Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc7 (ANAPC7) (NM_001137664) ICC Control Block
TB427559

USD 1,150.00

4 Weeks

Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc7 (ANAPC7) Cytosection
TS419871

USD 225.00

10 Weeks

Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Apc7 (ANAPC7) Cytosection
TS419871P5

USD 889.00

4 Weeks

Transient overexpression of ANAPC7 (NM_016238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Apc7 (ANAPC7) Cytosection
TS427559

USD 225.00

4 Weeks

Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Apc7 (ANAPC7) Cytosection
TS427559P5

USD 889.00

4 Weeks

Transient overexpression of ANAPC7 (NM_001137664) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack