PFKL (Myc-DDK-tagged)-Human phosphofructokinase, liver (PFKL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PFKL (Myc-DDK-tagged)-Human phosphofructokinase, liver (PFKL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PFKL (Myc-DDK-tagged)-Human phosphofructokinase, liver (PFKL), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PFKL (Myc-DDK tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PFKL (mGFP-tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PFKL (GFP-tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphofructokinase, liver (PFKL), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKL (Myc-DDK tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphofructokinase, liver (PFKL), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKL (mGFP-tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphofructokinase, liver (PFKL), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKL (Myc-DDK tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphofructokinase, liver (PFKL), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKL (mGFP-tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PFKL (GFP-tagged) - Human phosphofructokinase, liver (PFKL), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphofructokinase, liver (PFKL), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PFKL (untagged)-Human phosphofructokinase, liver (PFKL), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858) |
Transient overexpression lysate of phosphofructokinase, liver (PFKL), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PFKL (untagged)-Human phosphofructokinase, liver (PFKL), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PFKL rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Lenti ORF clone of Human phosphofructokinase, liver (PFKL), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PFKL (untagged)-Human phosphofructokinase, liver, mRNA (cDNA clone MGC:4256 IMAGE:3029577), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-K6PL antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human K6PL. |
Rabbit polyclonal PFKL Antibody (C-term L684)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL. |
PFKL rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 700-750 of Human PFKL. |
PFKL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PFKL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phosphofructokinase, liver (PFKL), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)
Reactivities | Human |
Rabbit Polyclonal Anti-PFKL Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFKL antibody: synthetic peptide directed towards the middle region of human PFKL. Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA |
Rabbit Polyclonal Anti-PFKL Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PFKL |
Transient overexpression of PFKL (NM_002626) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFKL (NM_001002021) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFKL (NM_002626) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PFKL (NM_002626) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PFKL (NM_001002021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PFKL (NM_001002021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack