Products

cDNA Clones (31)
Proteins (13)
Antibodies (3)
Jump to Filters
View as table Download
Chloride Channel 5 (CLCN5) (NM_000084) Human Tagged ORF Clone
RC217750

USD 420.00

In Stock

CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Chloride Channel 5 (CLCN5) (NM_000084) Human Tagged ORF Clone
RG217750

USD 460.00

In Stock

CLCN5 (GFP-tagged) - Human chloride channel 5 (CLCN5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_000084) Human Tagged ORF Clone Lentiviral Particle
RC217750L3V

USD 820.00

5 Weeks

Lenti ORF particles, CLCN5 (Myc-DDK tagged) - Human chloride channel 5 (CLCN5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_000084) Human Tagged ORF Clone Lentiviral Particle
RC217750L4V

USD 820.00

7 Weeks

Lenti ORF particles, CLCN5 (mGFP-tagged) - Human chloride channel 5 (CLCN5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_001127898) Human Tagged ORF Clone
RC226186

USD 910.00

4 Weeks

CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001127898) Human Tagged ORF Clone Lentiviral Particle
RC226186L3V

USD 1,310.00

7 Weeks

Lenti ORF particles, CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_001127898) Human Tagged ORF Clone Lentiviral Particle
RC226186L4V

USD 1,310.00

7 Weeks

Lenti ORF particles, CLCN5 (mGFP-tagged)-Human chloride channel 5 (CLCN5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_001127899) Human Tagged ORF Clone
RC226187

USD 910.00

4 Weeks

CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001127899) Human Tagged ORF Clone Lentiviral Particle
RC226187L3V

USD 1,310.00

7 Weeks

Lenti ORF particles, CLCN5 (Myc-DDK-tagged)-Human chloride channel 5 (CLCN5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_001127899) Human Tagged ORF Clone Lentiviral Particle
RC226187L4V

USD 1,310.00

7 Weeks

Lenti ORF particles, CLCN5 (mGFP-tagged)-Human chloride channel 5 (CLCN5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_001272102) Human Tagged ORF Clone
RC235441

USD 420.00

2 Weeks

CLCN5 (myc-DDK-tagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001282163) Human Tagged ORF Clone
RC239525

USD 610.00

3 Weeks

CLCN5 (myc-DDK-tagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001127898) Human Tagged ORF Clone
RG226186

USD 1,000.00

5 Weeks

CLCN5 (GFP-tagged) - Human chloride channel 5 (CLCN5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001127899) Human Tagged ORF Clone
RG226187

USD 1,000.00

5 Weeks

CLCN5 (GFP-tagged) - Human chloride channel 5 (CLCN5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) Rabbit Polyclonal Antibody
TA308868

USD 415.00

5 Days

Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795)
Chloride Channel 5 (CLCN5) Rabbit Polyclonal Antibody
TA332854

USD 275.00

3 Weeks

Rabbit anti-CLCN5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CLCN5
Chloride Channel 5 (CLCN5) (NM_000084) Human Tagged ORF Clone
RC217750L2

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 5 (CLCN5), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Chloride Channel 5 (CLCN5) (NM_000084) Human Over-expression Lysate
LY400025

USD 605.00

5 Days

Transient overexpression lysate of chloride channel 5 (CLCN5), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Chloride Channel 5 (CLCN5) (NM_000084) Human Untagged Clone
SC100001

USD 760.00

In Stock

CLCN5 (untagged)-Human chloride channel 5 (CLCN5), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Chloride Channel 5 (CLCN5) Rabbit Polyclonal Antibody
TA338390

USD 375.00

5 Days

Rabbit Polyclonal Anti-Clcn5 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clcn5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL
Chloride Channel 5 (CLCN5) (NM_000084) Human Over-expression Lysate
LC400025

USD 187.00

2 Weeks

CLCN5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Chloride Channel 5 (CLCN5) (NM_001272102) Human Tagged ORF Clone
RG235441

USD 460.00

2 Weeks

CLCN5 (GFP-tagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001282163) Human Tagged ORF Clone
RG239525

USD 650.00

2 Weeks

CLCN5 (GFP-tagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chloride Channel 5 (CLCN5) (NM_001272102) Human Untagged Clone
SC333335

USD 310.00

2 Weeks

CLCN5 (untagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Chloride Channel 5 (CLCN5) (NM_001282163) Human Untagged Clone
SC337419

USD 770.00

3 Weeks

CLCN5 (untagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Chloride Channel 5 (CLCN5) ICC Control Block
TB417750

USD 1,070.00

4 Weeks

Transient overexpression of CLCN5 (NM_000084) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Chloride Channel 5 (CLCN5) ICC Control Block
TB426186

USD 1,560.00

4 Weeks

Transient overexpression of CLCN5 (NM_001127898) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Chloride Channel 5 (CLCN5) ICC Control Block
TB426187

USD 1,560.00

4 Weeks

Transient overexpression of CLCN5 (NM_001127899) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Chloride Channel 5 (CLCN5) ICC Control Block
TB435441

USD 1,070.00

4 Weeks

Transient overexpression of CLCN5 (NM_001272102) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Chloride Channel 5 (CLCN5) ICC Control Block
TB439525

USD 1,260.00

4 Weeks

Transient overexpression of CLCN5 (NM_001282163) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Chloride Channel 5 (CLCN5) Cytosection
TS417750

USD 225.00

4 Weeks

Transient overexpression of CLCN5 (NM_000084) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Chloride Channel 5 (CLCN5) Cytosection
TS417750P5

USD 889.00

4 Weeks

Transient overexpression of CLCN5 (NM_000084) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Chloride Channel 5 (CLCN5) ICC Control Sections
TS426186P5

USD 889.00

4 Weeks

Transient overexpression of CLCN5 (NM_001127898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Chloride Channel 5 (CLCN5) ICC Control Sections
TS426187P5

USD 889.00

4 Weeks

Transient overexpression of CLCN5 (NM_001127899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Chloride Channel 5 (CLCN5) ICC Control Sections
TS435441P5

USD 889.00

4 Weeks

Transient overexpression of CLCN5 (NM_001272102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Chloride Channel 5 (CLCN5) ICC Control Sections
TS439525P5

USD 889.00

4 Weeks

Transient overexpression of CLCN5 (NM_001282163) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack