Germany
Japan
United Kingdom
China
DES (Myc-DDK-tagged)-Human desmin (DES)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
DES (GFP-tagged) - Human desmin (DES)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DES (Myc-DDK tagged) - Human desmin (DES), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DES (mGFP-tagged) - Human desmin (DES), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human desmin (DES), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DES (Myc-DDK tagged) - Human desmin (DES), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human desmin (DES), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DES (mGFP-tagged) - Human desmin (DES), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the middle region of human DES. Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT |
Recombinant protein of human desmin(DES),full length,with C-terminal flag tag, expressed in sf9 cells
| Tag | C-DDK |
| Expression Host | Sf9 |
Recombinant protein of human desmin (DES), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the N terminal of human DES. Synthetic peptide located within the following region: PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR |
Transient overexpression lysate of desmin (DES)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-Desmin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Desmin Antibody: A synthesized peptide derived from human Desmin |
Lenti ORF clone of Human desmin (DES), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human desmin (DES), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Desmin (DES) mouse monoclonal antibody, clone DES-82, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Desmin (DES) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
DES HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Purified recombinant protein of Human desmin (DES), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit anti Desmin (pT76/77)Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus with a dual phosphorylated threonine (Thr76/Thr77) of human Desmin. |
Rabbit anti Desmin (Paired T76/77) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus surrounding Threonine (Thr76/Thr77) without phosphorylation of human Desmin. |
Desmin human recombinant protein, 0.25 mg
| Expression Host | E. coli |
Desmin human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) DES mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Desmin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
DES (Desmin ) mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DES (Desmin ) mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
DES (Desmin ) mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DES (Desmin ) mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- DES
Families
- Druggable Genome