Germany
Japan
United Kingdom
China
Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli
| Tag | Tag Free |
| Expression Host | E. coli |
Products
View as table Download
FGF2 (Myc-DDK-tagged)-Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
FGF2 (untagged)-Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FGF2 (GFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, FGF2 (Myc-DDK tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FGF2 (mGFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, FGF2 (Myc-DDK tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FGF2 (mGFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2).
| Tag | Tag Free |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2)
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FGF basic / FGF2 human recombinant protein, 10 µg
| Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 25 µg
| Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 50 µg
| Expression Host | E. coli |
FGF2 mouse monoclonal antibody, clone F-474, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
FGF2 mouse monoclonal antibody, clone F-343, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-3, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-74, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit polyclonal anti-FGF-2 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant rat FGF-2 |
FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-FGF2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 215-229 amino acids of Human Fibroblast growth factor 2 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- FGF2
Families
- Druggable Genome