Germany
Japan
United Kingdom
China
FOXC1 (Myc-DDK-tagged)-Human forkhead box C1 (FOXC1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, FOXC1 (Myc-DDK tagged) - Human forkhead box C1 (FOXC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FOXC1 (mGFP-tagged) - Human forkhead box C1 (FOXC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FOXC1 (GFP-tagged) - Human forkhead box C1 (FOXC1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human forkhead box C1 (FOXC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FOXC1 (Myc-DDK tagged) - Human forkhead box C1 (FOXC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FOXC1 (mGFP-tagged) - Human forkhead box C1 (FOXC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FOXC1 (untagged)-Human forkhead box C1 (FOXC1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human forkhead box C1 (FOXC1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human forkhead box C1 (FOXC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human forkhead box C1 (FOXC1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FOXC1 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Porcine |
| Immunogen | Dynthetic peptide from an internal region of Human FOXC1 (NP_001444.2). |
FOXC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of forkhead box C1 (FOXC1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-FOXC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the N terminal of human FOXC1. Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI |
FOXC1 (untagged)-Human forkhead box C1 (FOXC1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-FOXC1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXC1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FOXC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: GERGGHLQGAPGGAGGSAVDNPLPDYSLPPVTSSSSSSLSHGGGGGGGGG |
Rabbit Polyclonal Anti-FOXC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC |
Rabbit Polyclonal Anti-Foxc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxc1 antibody: synthetic peptide directed towards the n terminal of mouse Foxc1. Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP |
Purified recombinant protein of Human forkhead box C1 (FOXC1), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-FOXC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOXC1 |
Transient overexpression of FOXC1 (NM_001453) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human forkhead box C1 (FOXC1), Pro197-Gln306, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of FOXC1 (NM_001453) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FOXC1 (NM_001453) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- FOXC1
Families
- Druggable Genome