GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK4 Mutant (R65L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 4 (GRK4), transcript variant 1 as transfection-ready DNA
Mutation | R65L |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK4 Mutant (A142V), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 4 (GRK4), transcript variant 1 as transfection-ready DNA
Mutation | A142V |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GRK4 Mutant (V486A), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 4 (GRK4), transcript variant 1 as transfection-ready DNA
Mutation | V486A |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GRK4 (mGFP-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK4 (mGFP-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GRK4 (myc-DDK-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GRK4 (untagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Anti-GRK4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4 |
Transient overexpression lysate of G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Purified recombinant protein of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, Met1-Arg245, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
GRK4 (untagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GRK4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY |
Rabbit Polyclonal Anti-GRK4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA |
Carrier-free (BSA/glycerol-free) GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GRK4 MS Standard C13 and N15-labeled recombinant protein (NP_892027)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GRK4 (untagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GRK4 (untagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-GRK4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4 |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |