Germany
Japan
United Kingdom
China
USD 98.00
USD 460.00
In Stock
MAPKAPK2 (Myc-DDK-tagged)-Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MAPKAPK2 (Myc-DDK-tagged)-Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 1,020.00
3 Weeks
Lenti ORF particles, MAPKAPK2 (mGFP-tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, MAPKAPK2 (Myc-DDK tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, MAPKAPK2 (mGFP-tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, MAPKAPK2 (Myc-DDK tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, MAPKAPK2 (mGFP-tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, MAPKAPK2 (Myc-DDK tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, MAPKAPK2 (Myc-DDK tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, MAPKAPK2 (mGFP-tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAPKAPK2 (GFP-tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPKAPK2 (GFP-tagged) - Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPKAPK2 (untagged)-Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal MAPKAPK2 (Ab-272) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G). |
Rabbit polyclonal MAPKAPK2 (Ser272) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G). |
| Modifications | Phospho-specific |
Lenti ORF clone of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MAPKAPK2 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAPKAPK2 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal MAPKAPK2 (Thr334) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of threonine 334 (P-Q-TP-P-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPKAP Kinase 2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Immunogen: This antibody was affinity purified from whole rabbit serum prepared by repeated immunizations with a synthetic peptide corresponding to aa 310-325 of rabbit MAPKAP Kinase 2 conjugated to KLH using maleimide. A terminal cysteine residue was added to facilitate coupling. |
Rabbit Polyclonal Anti-MAPKAPK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPKAPK2 antibody is: synthetic peptide directed towards the C-terminal region of Human MAPKAPK2. Synthetic peptide located within the following region: MNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKNSDQATWLTR |
Rabbit Polyclonal Anti-MAPKAPK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPKAPK2 antibody: synthetic peptide directed towards the middle region of human MAPKAPK2. Synthetic peptide located within the following region: KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY |
MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_116584)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_004750)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAPKAPK2 (untagged)-Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-MAPKAPK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPKAPK2 |
Transient overexpression of MAPKAPK2 (NM_032960) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPKAPK2 (NM_004759) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPKAPK2 (NM_032960) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPKAPK2 (NM_032960) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAPKAPK2 (NM_004759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPKAPK2 (NM_004759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MAPKAPK2
Families
- Druggable Genome