Products

cDNA Clones (11)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
PNK (PNKP) (NM_007254) Human Tagged ORF Clone
RC207551

USD 480.00

In Stock

PNKP (Myc-DDK-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PNK (PNKP) (NM_007254) Human Tagged ORF Clone
RG207551

USD 530.00

In Stock

PNKP (GFP-tagged) - Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PNK (PNKP) (NM_007254) Human Tagged ORF Clone
RC207551L3

USD 680.00

3 Weeks

Lenti-ORF clone of PNKP (Myc-DDK-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PNK (PNKP) (NM_007254) Human Tagged ORF Clone
RC207551L4

USD 680.00

3 Weeks

Lenti-ORF clone of PNKP (mGFP-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PNK (PNKP) (NM_007254) Human Untagged Clone
SC128040

USD 310.00

In Stock

PNKP (untagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PNK (PNKP) (NM_007254) Human Tagged ORF Clone
RC207551L2

USD 680.00

3 Weeks

Lenti-ORF clone of PNKP (mGFP-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PNK (PNKP) (NM_007254) Human Over-expression Lysate
LC416093

USD 121.00

In Stock

PNKP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PNK (PNKP) (NM_007254) Human Over-expression Lysate
LY416093

USD 396.00

In Stock

Transient overexpression lysate of polynucleotide kinase 3'-phosphatase (PNKP)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PNK (PNKP) (NM_007254) Human Untagged Clone
SC323976

USD 310.00

In Stock

PNKP (untagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PNK (PNKP) Rabbit Polyclonal Antibody
TA319448

USD 530.00

5 Days

Rabbit polyclonal anti-PNK antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PNK protein.
PNK (PNKP) Rabbit Polyclonal Antibody
TA340167

USD 375.00

5 Days

Rabbit Polyclonal Anti-PNKP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNKP antibody: synthetic peptide directed towards the N terminal of human PNKP. Synthetic peptide located within the following region: MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ
PNK (PNKP) Rabbit Polyclonal Antibody
TA340168

USD 375.00

5 Days

Rabbit Polyclonal Anti-PNKP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNKP antibody: synthetic peptide directed towards the middle region of human PNKP. Synthetic peptide located within the following region: ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT
PNK (PNKP) (NM_007254) Human Mass Spec Standard
PH307551

USD 2,055.00

3 Weeks

PNKP MS Standard C13 and N15-labeled recombinant protein (NP_009185)

Tag C-Myc/DDK
Expression Host HEK293
PNK (PNKP) (NM_007254) ICC Control Block
TB407551

USD 1,130.00

4 Weeks

Transient overexpression of PNKP (NM_007254) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PNK (PNKP) Cytosection
TS407551

USD 225.00

4 Weeks

Transient overexpression of PNKP (NM_007254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PNK (PNKP) Cytosection
TS407551P5

USD 889.00

4 Weeks

Transient overexpression of PNKP (NM_007254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack