Germany
Japan
United Kingdom
China
PNKP (Myc-DDK-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadRecombinant protein of human polynucleotide kinase 3'-phosphatase (PNKP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PNKP (Myc-DDK-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PNKP (mGFP-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Pnkp (Myc-DDK-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PNKP (GFP-tagged) - Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pnkp (myc-DDK-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PNKP - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407551 is the updated version of KN207551.
Pnkp - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513529 is the updated version of KN313529.
Pnkp (GFP-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pnkp (Myc-DDK-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pnkp (Myc-DDK-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pnkp (mGFP-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pnkp (GFP-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pnkp (myc-DDK-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pnkp (myc-DDK-tagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PNKP (Myc-DDK-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PNKP (Myc-DDK-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PNKP (mGFP-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PNKP (mGFP-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pnkp (Myc-DDK-tagged ORF) - Rat polynucleotide kinase 3'-phosphatase (Pnkp), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pnkp (Myc-DDK-tagged ORF) - Rat polynucleotide kinase 3'-phosphatase (Pnkp), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pnkp (Myc-DDK-tagged ORF) - Rat polynucleotide kinase 3'-phosphatase (Pnkp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pnkp (mGFP-tagged ORF) - Rat polynucleotide kinase 3'-phosphatase (Pnkp), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pnkp (GFP-tagged ORF) - Rat polynucleotide kinase 3'-phosphatase (Pnkp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PNKP (untagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of PNKP (mGFP-tagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PNKP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polynucleotide kinase 3'-phosphatase (PNKP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PNKP (untagged)-Human polynucleotide kinase 3'-phosphatase (PNKP)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-PNK antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PNK protein. |
Rabbit Polyclonal Anti-PNKP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNKP antibody: synthetic peptide directed towards the N terminal of human PNKP. Synthetic peptide located within the following region: MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ |
Rabbit Polyclonal Anti-PNKP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNKP antibody: synthetic peptide directed towards the middle region of human PNKP. Synthetic peptide located within the following region: ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT |
PNKP CRISPRa kit - CRISPR gene activation of human polynucleotide kinase 3'-phosphatase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pnkp CRISPRa kit - CRISPR gene activation of mouse polynucleotide kinase 3'- phosphatase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PNKP
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PNKP
Pnkp (untagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pnkp (untagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pnkp (untagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pnkp (untagged) - Mouse polynucleotide kinase 3'- phosphatase (Pnkp), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Pnkp
PNKP MS Standard C13 and N15-labeled recombinant protein (NP_009185)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Pnkp (untagged ORF) - Rat polynucleotide kinase 3'-phosphatase (Pnkp), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of polynucleotide kinase 3'-phosphatase (PNKP) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Pnkp (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pnkp (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PNKP Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-320 of human PNKP (NP_009185.2). |
| Modifications | Unmodified |
Transient overexpression of PNKP (NM_007254) in HEK293T cells paraffin embedded controls for ICC/IHC staining
PNKP - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- PNKP