Germany
Japan
United Kingdom
China
PPP2R1A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PPP2R1A (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, PPP2R1A (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PPP2R1A (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PPP2R1A (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PPP2R1A (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP2R1A (untagged)-Homo sapiens, clone MGC:786 IMAGE:2987938, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPP2R1A (untagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PPP2R1A (untagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1A sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD |
PPP2R1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPP2R1A MS Standard C13 and N15-labeled recombinant protein (NP_055040)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of PPP2R1A (NM_014225) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R1A (NM_014225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP2R1A (NM_014225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPP2R1A
Families
- Druggable Genome