Germany
Japan
United Kingdom
China
PPP2R1A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PPP2R1A (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, PPP2R1A (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Ppp2r1a (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (Ppp2r1a)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PPP2R1A (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R1A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400056 is the updated version of KN200056.
Ppp2r1a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513767 is the updated version of KN313767.
Ppp2r1a (GFP-tagged) - Mouse protein phosphatase 2 (formerly 2A) regulatory subunit A (PR 65) alpha isoform (Ppp2r1a), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp2r1a (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (Ppp2r1a)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r1a (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (Ppp2r1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp2r1a (mGFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (Ppp2r1a)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r1a (GFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (Ppp2r1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PPP2R1A (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PPP2R1A (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ppp2r1a (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (Ppp2r1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp2r1a (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (Ppp2r1a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r1a (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (Ppp2r1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp2r1a (mGFP-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (Ppp2r1a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r1a (GFP-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (Ppp2r1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP2R1A (untagged)-Homo sapiens, clone MGC:786 IMAGE:2987938, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PPP2R1A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PPP2R1A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPP2R1A (untagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PPP2R1A (untagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1A sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD |
PPP2R1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPP2R1A - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
PPP2R1A CRISPRa kit - CRISPR gene activation of human protein phosphatase 2 scaffold subunit Aalpha
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PPP2R1A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PPP2R1A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PPP2R1A
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Ppp2r1a (untagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform (Ppp2r1a), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ppp2r1a
PPP2R1A MS Standard C13 and N15-labeled recombinant protein (NP_055040)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ppp2r1a (untagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (Ppp2r1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of protein phosphatase 2 (formerly 2A) regulatory subunit A alpha isoform (PPP2R1A) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Ppp2r1a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Ppp2r1a (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- PPP2R1A