Products

cDNA Clones (23)
Proteins (16)
Antibodies (1)
Jump to Filters
View as table Download
PPP2R2C (NM_181876) Human Tagged ORF Clone
RC214086

USD 420.00

In Stock

PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R2C (NM_020416) Human Tagged ORF Clone
RC224154

USD 420.00

In Stock

PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R2C (NM_181876) Human Tagged ORF Clone
RC214086L3

USD 620.00

3 Weeks

Lenti-ORF clone of PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_181876) Human Tagged ORF Clone Lentiviral Particle
RC214086L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_181876) Human Tagged ORF Clone
RC214086L4

USD 620.00

3 Weeks

Lenti-ORF clone of PPP2R2C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_181876) Human Tagged ORF Clone Lentiviral Particle
RC214086L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R2C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_020416) Human Tagged ORF Clone
RC224154L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_020416) Human Tagged ORF Clone Lentiviral Particle
RC224154L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R2C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_020416) Human Tagged ORF Clone
RC224154L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_020416) Human Tagged ORF Clone Lentiviral Particle
RC224154L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R2C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R2C (NM_001206996) Human Tagged ORF Clone
RC232707

USD 450.00

2 Weeks

PPP2R2C (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_001206994) Human Tagged ORF Clone
RC232728

USD 420.00

2 Weeks

PPP2R2C (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_001206995) Human Tagged ORF Clone
RC232729

USD 420.00

2 Weeks

PPP2R2C (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_181876) Human Tagged ORF Clone
RG214086

USD 460.00

3 Weeks

PPP2R2C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_020416) Human Tagged ORF Clone
RG224154

USD 460.00

3 Weeks

PPP2R2C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_001206996) Human Tagged ORF Clone
RG232707

USD 500.00

3 Weeks

PPP2R2C (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_001206994) Human Tagged ORF Clone
RG232728

USD 460.00

3 Weeks

PPP2R2C (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C (NM_001206995) Human Tagged ORF Clone
RG232729

USD 460.00

3 Weeks

PPP2R2C (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R2C Rabbit Polyclonal Antibody
TA344602

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY
PPP2R2C (NM_181876) Human Untagged Clone
SC127988

USD 750.00

In Stock

PPP2R2C (untagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PPP2R2C (NM_181876) Human Over-expression Lysate
LC405568

USD 187.00

2 Weeks

PPP2R2C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R2C (NM_020416) Human Over-expression Lysate
LC412468

USD 187.00

2 Weeks

PPP2R2C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R2C (NM_181876) Human Over-expression Lysate
LY405568

USD 605.00

5 Days

Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (PPP2R2C), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PPP2R2C (NM_020416) Human Over-expression Lysate
LY412468

USD 605.00

5 Days

Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (PPP2R2C), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PPP2R2C (NM_020416) Human Untagged Clone
SC313520

USD 750.00

3 Weeks

PPP2R2C (untagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PPP2R2C (NM_001206994) Human Untagged Clone
SC329878

USD 450.00

3 Weeks

PPP2R2C (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PPP2R2C (NM_001206995) Human Untagged Clone
SC329879

USD 450.00

3 Weeks

PPP2R2C (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 4

Vector pCMV6 series
Tag Tag Free
PPP2R2C (NM_001206996) Human Untagged Clone
SC329880

USD 430.00

3 Weeks

PPP2R2C (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 5

Vector pCMV6 series
Tag Tag Free
PPP2R2C ICC Control Block
TB414086

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R2C (NM_181876) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PPP2R2C ICC Control Block
TB424154

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R2C (NM_020416) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PPP2R2C ICC Control Block
TB432707

USD 1,100.00

4 Weeks

Transient overexpression of PPP2R2C (NM_001206996) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PPP2R2C ICC Control Block
TB432728

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R2C (NM_001206994) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PPP2R2C ICC Control Block
TB432729

USD 1,070.00

4 Weeks

Transient overexpression of PPP2R2C (NM_001206995) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PPP2R2C Cytosection
TS414086

USD 225.00

4 Weeks

Transient overexpression of PPP2R2C (NM_181876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PPP2R2C Cytosection
TS414086P5

USD 889.00

4 Weeks

Transient overexpression of PPP2R2C (NM_181876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PPP2R2C Cytosection
TS424154

USD 225.00

4 Weeks

Transient overexpression of PPP2R2C (NM_020416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PPP2R2C Cytosection
TS424154P5

USD 889.00

4 Weeks

Transient overexpression of PPP2R2C (NM_020416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PPP2R2C ICC Control Sections
TS432707P5

USD 889.00

4 Weeks

Transient overexpression of PPP2R2C (NM_001206996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PPP2R2C ICC Control Sections
TS432728P5

USD 889.00

4 Weeks

Transient overexpression of PPP2R2C (NM_001206994) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PPP2R2C ICC Control Sections
TS432729P5

USD 889.00

4 Weeks

Transient overexpression of PPP2R2C (NM_001206995) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack